| request information: |
|
| Catalog Code: | H00009138-M01 |
| Product Name: | ARHGEF1 Antibody |
| Product Description: | Mouse Monoclonal anti-ARHGEF1 (1H4) |
| Clone: | 1H4 |
| Clonality: | Monoclonal |
| ListPrice: | 295 |
| Gene ID: | 9138 |
| Gene Symbol: | ARHGEF1 |
| Omim ID: | 601855, |
| Immunogen: | ARHGEF1 (AAH34013, 830 a.a. ~ 927 a.a) partial recombinant protein with GST tag. |
| Epitope: | CRPGPEGQLAATALRKVLSLKQLLFPAEEDNGAGPPRDGDGVPGGGPLSPARTQEIQENLLSLEETMKQLEELEEEFCR
LRPLLSQLGGNSVPQPGCT |
| Cross Reactivity: | Human. Other species not tested. |
| Packaging: | 0.1 mg IgG purified Mouse ascites. |
| Uses: | Antibody Reactive against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control. |
| Background: | Rho GTPases play a fundamental role in numerous cellular processes that are initiated by extracellular stimuli that work through G protein coupled receptors. The encoded protein may form complex with G proteins and stimulate Rho-dependent signals. Multiple alternatively spliced transcript variants have been found for this gene, but the full-length nature of some variants has not been defined. |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | IgG purified |
| Isotype: | IgG2a Kappa |
| Host Name: | Mouse |
| Buffer: | In 1x PBS, pH 7.2 |
| Application Summary: | ELISA, Western Blot |
| Species Summary: | Hu |
| Alternate Names: | anti-GEF1 antibody, anti-LBCL2 antibody, anti-P115-RHOGEF antibody, anti-SUB1.5 antibody |
| Package Size: | 0.1 mg |
| Preservative: | No preservative |
order or
more information: | company product webpage |