| CatalogCode: | H00009131-B01 |
| ProductType: | Primary Antibody |
| ProductName: | PDCD8 Antibody |
| ListPrice: | 295 |
| Clonality: | Polyclonal |
| Gene_Id: | 9131 |
| Host: | Mouse |
| ProductDescription: | Mouse Polyclonal anti-PDCD8 - programmed cell death 8 (apoptosis-inducing factor), MaxPab Antibody |
| CrossReactivity: | Human. |
| SpeciesSummary: | Hu |
| Background: | This gene encodes a flavoprotein essential for nuclear disassembly in apoptotic cells that is found in the mitochondrial intermembrane space in healthy cells. Induction of apoptosis results in the translocation of this protein to the nucleus where it effe |
| ALTnames: | anti-AIF antibody, anti-MGC111425 antibody |
| Immunogen: | PDCD8 (NP_004199, 1 a.a. ~ 613 a.a) full-length human protein. |
| Epitope: | MFRCGGLAAGALKQKLVPLVRTVCVRSPRQRNRLPGNLFQRWHVPLELQMTRQMASSGASGGKIDNSVLVLIVGLSTVGAGAYAYKTMKEDEKRYNERISGLGLTPEQKQKKAALSASEGEEVPQDKAPSHVPFLLIGGGTAAFAAARSIRARDPGARVLIVSEDPELPYMRPPLSKELWFSDDPNVTKTLRFKQWNGKERSIYFQPPSFYVSAQDLPHIENGGVAVLTGKKVVQLDVRDNMVKLNDGSQITYEK ... |
| Preservative: | No Preservative |
| Packaging: | 50 ul of mouse antisera with 50% glycerol. |
| PackageSize: | 0.05 ml |
| Uses: | Antibody Reactive Against Immunizing Recombinant Protein or Transfected Lysate on ELISA and Western Blot. |
| AppSummary: | WB, ELISA |
| Storage: | Aliquot and store at -20C or -80C.á Avoid freeze-thaw cycles. |