| request information: |
|
| Catalog Code: | H00009130-M02 |
| Product Name: | FAM50A Antibody |
| Product Description: | Mouse Monoclonal anti-FAM50A (5F10) |
| Clone: | 5F10 |
| Clonality: | Monoclonal |
| ListPrice: | 295 |
| Gene ID: | 9130 |
| Gene Symbol: | FAM50A |
| Omim ID: | 300453, |
| Immunogen: | FAM50A (NP_004690, 1 a.a. ~ 89 a.a) partial recombinant protein with GST tag. |
| Epitope: | MAQYKGAASEAGRAMHLMKKREKQREQMEQMKQRIAEENIMKSNIDKKFSAHYDAVEAELKSSTVGLVTLNDMKAKQEA
LVKEREKQL* |
| Specificity: | FAM50A - family with sequence similarity 50, member A |
| Cross Reactivity: | Human. Other species not tested. |
| Packaging: | 0.1 mg IgG purified Mouse ascites. |
| Uses: | Antibody reactive against cell lysate and recombinant protein for western blot. It has also been used for ELISA. |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | IgG purified |
| Isotype: | IgG2a Kappa |
| Host Name: | Mouse |
| Application Summary: | ELISA, Western Blot |
| Species Summary: | Hu , |
| Alternate Names: | anti-9F antibody, anti-DXS9928E antibody, anti-HXC-26 antibody, anti-XAP5 antibody |
| Package Size: | 0.1 mg |
| Preservative: | No preservative |
order or
more information: | company product webpage |