| request information: |
|
| Catalog Code: | H00009117-A01 |
| Product Name: | SEC22L3 Antibody |
| Product Description: | Mouse Polyclonal anti-SEC22L3 |
| Clonality: | Polyclonal |
| ListPrice: | 225 |
| Gene ID: | 9117 |
| Gene Symbol: | SEC22L3 |
| Omim ID: | 604028, |
| Immunogen: | SEC22L3 (NP_116752, 3 a.a. ~ 69 a.a) partial recombinant protein with GST tag. |
| Epitope: | VIFFACVVRVRDGLPLSASTDFYHTQDFLEWRRRLKSLALRLAQYPGRGSAEGCDFSIHFSSFGDV* |
| Specificity: | SEC22L3 - SEC22 vesicle trafficking protein-like 3 (S. cerevisiae) |
| Cross Reactivity: | Human. Other species not tested. |
| Packaging: | 0.05 ml of mouse antisera with 50% glycerol. No preservative. |
| Uses: | The quality control of this antibody is limited to Western blot on the immunizing protein. Abnovas recommended working dilutions for western analysis are as follows:1:500 dilution for ascites1:1000 for purified Ig1:500-1:1000 for polysera |
| Background: | The protein encoded by this gene is a member of the SEC22 family of vesicle trafficking proteins. It is localized at the endoplasmic reticulum and it is thought to play a role in the early stages of the ER-Golgi protein trafficking. There are two alternatively spliced transcript variants encoding different isoforms described for this gene. |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | Whole antisera |
| Host Name: | Mouse |
| Application Summary: | ELISA, Western Blot |
| Species Summary: | Hu |
| Alternate Names: | anti-DKFZp761F2321 antibody, anti-MGC13261 antibody, anti-MGC5373 antibody, anti-SEC22C antibody |
| Package Size: | 0.05 ml |
| Preservative: | No preservative |
order or
more information: | company product webpage |