| Catalog Code: | H00009111-M04 |
| Product Type: | Primary Antibody |
| Product Name: | NMI Antibody |
| List Price: | 275 |
| Clonality: | Monoclonal |
| Gene ID: | 9111 |
| Host: | Mouse |
| Clone: | 9E8 |
| Isotype: | IgG2b Kappa |
| Product Description: | Mouse Monoclonal anti-NMI (9E8) |
| Cross Reactivity: | Human. Other species not tested. |
| Species Summary: | Hu |
| Background: | NMYC interactor (NMI) encodes a protein that interacts with NMYC and CMYC (two members of the oncogene Myc family), and other transcription factors containing a Zip, HLH, or HLH-Zip motif. The NMI protein also interacts with all STATs except STAT2 and aug |
| Immunogen: | NMI (AAH01268, 1 a.a. ~ 101 a.a) partial recombinant protein with GST tag. |
| Epitope: | MEADKDDTQQILKEHSPDEFIKDEQNKGLIDEITKKNIQLKKEIQKLETELQEATKEFQIKEDIPETKMKFLSVETPENDSQLSNISCSFQVSSKVPYEI* ... |
| Purity: | IgG purified |
| Buffer: | In 1x PBS, pH 7.2 |
| Packaging: | 0.1 mg IgG purified Mouse ascites. |
| Package Size: | 0.1 mg |
| Uses: | Antibody Reactive against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control. The antibody is also shown to be specific in Western blot against cell lysates. |
| Application Summary: | ELISA, WB |
| Notes Main: | This antibody is available only in North America and is supplied by Abnova The immunizing protein is also available for this product. Unit cost for the protein is $ 235 (2 ug), $ 285 (10 ug), and $ 425 (25 ug). |
| Gene Symbol: | NMI |
| Omim ID: | 603525, |