ExactAntigen

NMI Antibody
For more information about this product,
enter your email address here
or visit directly company product webpage
.
Catalog Code:H00009111-M04
Product Type:Primary Antibody
Product Name:NMI Antibody
List Price:275
Clonality:Monoclonal
Gene ID:9111
Host:Mouse
Clone:9E8
Isotype:IgG2b Kappa
Product Description:Mouse Monoclonal anti-NMI (9E8)
Cross Reactivity:Human. Other species not tested.
Species Summary:Hu
Background:NMYC interactor (NMI) encodes a protein that interacts with NMYC and CMYC (two members of the oncogene Myc family), and other transcription factors containing a Zip, HLH, or HLH-Zip motif. The NMI protein also interacts with all STATs except STAT2 and aug
Immunogen:NMI (AAH01268, 1 a.a. ~ 101 a.a) partial recombinant protein with GST tag.
Epitope:MEADKDDTQQILKEHSPDEFIKDEQNKGLIDEITKKNIQLKKEIQKLETELQEATKEFQIKEDIPETKMKFLSVETPENDSQLSNISCSFQVSSKVPYEI* ...
Purity:IgG purified
Buffer:In 1x PBS, pH 7.2
Packaging:0.1 mg IgG purified Mouse ascites.
Package Size:0.1 mg
Uses:Antibody Reactive against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control. The antibody is also shown to be specific in Western blot against cell lysates.
Application Summary:ELISA, WB
Notes Main:This antibody is available only in North America and is supplied by Abnova The immunizing protein is also available for this product. Unit cost for the protein is $ 235 (2 ug), $ 285 (10 ug), and $ 425 (25 ug).
Gene Symbol:NMI
Omim ID:603525,
see all human NMI antibodies
see anti mouse secondary antibodies


2008©ExactAntigen home | browse | about