ExactAntigen

Mouse Monoclonal anti-NMI (1E6) | Novus Biologicals antibody product information
CatalogCode:H00009111-M02
ProductName:NMI Antibody
Product Description:Mouse Monoclonal anti-NMI (1E6)
Clone:1E6
Clonality:Monoclonal
Immunogen:NMI (AAH01268, 1 a.a. ~ 101 a.a) partial recombinant protein with GST tag.
Epitope:MEADKDDTQQILKEHSPDEFIKDEQNKGLIDEITKKNIQLKKEIQKLETELQEATKEFQIKEDIPETKMKFLSVETPENDSQLSNISCSFQVSSKVPYEI* ...
CrossReactivity:Human. Other species not tested.
Packaging:0.1 mg IgG purified Mouse ascites.
Uses:Antibody Reactive against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control. The antibody is also shown to be specific in Western blot against cell lysates.
Background:NMYC interactor (NMI) encodes a protein that interacts with NMYC and CMYC (two members of the oncogene Myc family), and other transcription factors containing a Zip, HLH, or HLH-Zip motif. The NMI protein also interacts with all STATs except STAT2 and augments STAT-mediated transcription in response to cytokines IL2 and IFN-gamma. The NMI mRNA has low expression levels in all human fetal and adult tissues tested except brain and has high expression in cancer cell line-myeloid leukemias.
Storage:Aliquot and store at -20C or -80C.  Avoid freeze-thaw cycles.
Purity:IgG purified
Isotype:IgG2b Kappa
Host_Name:Mouse
Buffer:In 1x PBS, pH 7.2
ListPrice:295
AppSummary:ELISA, WB
SpeciesSummary:Hu
ALTnames:anti-N-myc Interactor antibody, anti-STAT Interactor antibody
ProteinTarget:N-myc (and STAT) interactor
PackageSize:0.1 mg
NotesMain:This antibody is available only in North America and is supplied by Abnova If in stock in Taiwan. delivery is 10-14 days. If not in stock. lead times can be extended. We will inform you of any extended delays within 48 hours. The immunizing protein is also available for this product. Unit cost for the protein is $ 250 (2 ug). $ 305 (10 ug). and $ 445 (25 ug).
Gene_Id:9111
Gene_Symbol:NMI
Omim_ID:603525,
order or
more information
:
company product webpage
request information:
Also see:
all human NMI antibodies
anti mouse secondary antibodies


2008©ExactAntigen home | browse | about