| request information: |
|
| Catalog Code: | H00009111-A01 |
| Product Name: | NMI Antibody |
| Product Description: | Mouse Polyclonal anti-NMI |
| Clonality: | Polyclonal |
| ListPrice: | 225 |
| Gene ID: | 9111 |
| Gene Symbol: | NMI |
| Omim ID: | 603525 |
| Immunogen: | NMI (AAH01268, 1 a.a. ~ 101 a.a) partial recombinant protein with GST tag. |
| Epitope: | MEADKDDTQQILKEHSPDEFIKDEQNKGLIDEITKKNIQLKKEIQKLETELQEATKEFQIKEDIPETKMKFLSVETPEN
DSQLSNISCSFQVSSKVPYEI* |
| Specificity: | NMI - N-myc (and STAT) interactor |
| Cross Reactivity: | Human. Other species not tested. |
| Packaging: | 0.05 ml of mouse antisera with 50% glycerol. No preservative. |
| Uses: | The quality control of this antibody is limited to Western blot on the immunizing protein. Abnovas recommended working dilutions for western analysis are as follows:1:500 dilution for ascites1:1000 for purified Ig1:500-1:1000 for polysera |
| Background: | NMYC interactor (NMI) encodes a protein that interacts with NMYC and CMYC (two members of the oncogene Myc family), and other transcription factors containing a Zip, HLH, or HLH-Zip motif. The NMI protein also interacts with all STATs except STAT2 and augments STAT-mediated transcription in response to cytokines IL2 and IFN-gamma. The NMI mRNA has low expression levels in all human fetal and adult tissues tested except brain and has high expression in cancer cell line-myeloid leukemias. |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | Whole antisera |
| Host Name: | Mouse |
| Application Summary: | ELISA, Western Blot |
| Species Summary: | Hu |
| Alternate Names: | anti-N-myc Interactor antibody, anti-STAT Interactor antibody |
| Package Size: | 0.05 ml |
| Preservative: | No preservative |
order or
more information: | company product webpage |