| request information: |
|
| Catalog Code: | H00009097-M08 |
| Product Name: | USP14 Antibody |
| Product Description: | Mouse Monoclonal anti-USP14 - ubiquitin specific peptidase 14 (tRNA-guanine transglycosylase) (1F8) |
| Clone: | 1F8 |
| Clonality: | Monoclonal |
| ListPrice: | 295 |
| Gene ID: | 9097 |
| Gene Symbol: | USP14 |
| Immunogen: | USP14 (NP_005142, 395 a.a. ~ 495 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Epitope: | PQKEVKYEPFSFADDIGSNNCGYYDLQAVLTHQGRSSSSGHYVSWVKRKQDEWIKFDDDKVSIVTPEDILRLSGGGDWH
IAYVLLYGPRRVEIMEEESEQ* |
| Cross Reactivity: | Human. |
| Packaging: | 0.1 mg IgG purified Mouse ascites. |
| Uses: | Antibody reactive against cell lysate and recombinant protein for western blot. It has also been used for ELISA. |
| Background: | This gene encodes a member of the ubiquitin-specific processing (UBP) family of proteases that is a deubiquitinating enzyme (DUB) with His and Cys domains. This protein is located in the cytoplasm and cleaves the ubiquitin moiety from ubiquitin-fused precursors and ubiquitinylated proteins. Mice with a mutation that results in reduced expression of the ortholog of this protein are retarded for growth, develop severe tremors by 2 to 3 weeks of age followed by hindlimb paralysis and death by 6 to 10 weeks of age. Alternate transcriptional splice variants, encoding different isoforms, have been characterized. |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | IgG purified |
| Isotype: | IgG2a Kappa |
| Host Name: | Mouse |
| Buffer: | In 1x PBS, pH 7.2 |
| Application Summary: | ELISA, Western Blot |
| Species Summary: | Hu |
| Alternate Names: | anti-TGT antibody |
| Package Size: | 0.1 mg |
| Preservative: | No Preservative |
order or
more information: | company product webpage |