| request information: |
|
| Catalog Code: | H00009097-M04 |
| Product Name: | USP14 Antibody |
| Product Description: | Mouse Monoclonal anti-USP14 (6D6) |
| Clone: | 6D6 |
| Clonality: | Monoclonal |
| ListPrice: | 295 |
| Gene ID: | 9097 |
| Gene Symbol: | USP14 |
| Omim ID: | 607274, |
| Immunogen: | USP14 (NP_005142, 395 a.a. ~ 495 a.a) partial recombinant protein with GST tag. |
| Epitope: | PQKEVKYEPFSFADDIGSNNCGYYDLQAVLTHQGRSSSSGHY VSWVKRKQDEWIKFDDDKVSIVTPEDILRLSGGGDWHIAYVL LYGPRRVEIMEEESEQ* |
| Specificity: | USP14 - ubiquitin specific peptidase 14 (tRNA-guanine transglycosylase) |
| Cross Reactivity: | Human. Other species not tested. |
| Packaging: | 0.1 mg IgG purified Mouse ascites. |
| Uses: | Antibody reactive against cell lysate and recombinant protein for Western Blot. Has also been used for immunofluoresence and ELISA. |
| Background: | This gene encodes a member of the ubiquitin-specific processing (UBP) family of proteases that is a deubiquitinating enzyme (DUB) with His and Cys domains. This protein is located in the cytoplasm and cleaves the ubiquitin moiety from ubiquitin-fused precursors and ubiquitinylated proteins. Mice with a mutation that results in reduced expression of the ortholog of this protein are retarded for growth, develop severe tremors by 2 to 3 weeks of age followed by hindlimb paralysis and death by 6 to 10 weeks of age. Alternate transcriptional splice variants, encoding different isoforms, have been characterized. |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | IgG purified |
| Isotype: | IgG2a Kappa |
| Host Name: | Mouse |
| Buffer: | Phosphate buffered saline, pH 7.2 |
| Application Summary: | ELISA, immunofluorescence, Western Blot |
| Species Summary: | Hu |
| Alternate Names: | anti-Deubiquitinating enzyme 14 antibody, anti-TGT antibody, anti-tRNA guanine transglycosylase 60 kD subunit antibody, anti-tRNA guanine transglycosylase antibody, anti-Ubiquitin carboxyl terminal hydrolase 14 antibody, anti-Ubiquitin specific processing protease 14 antibody, anti-Ubiquitin specific protease 14 antibody, anti-Ubiquitin thiolesterase 14 antibody, anti-USP 14 antibod |
| Package Size: | 0.1 mg |
| Preservative: | No preservative |
| Novus References: | Proteasome Function Is Required for DNA Damage Response and Fanconi Anemia Pathway Activation. Jacquemont, C. and Taniguchi, T. Cancer Res., Aug 2007; 67: 7395 - 7405. |
order or
more information: | company product webpage |