| request information: | |
| Catalog Code: | H00009079-M01 |
| Product Name: | LDB2 Antibody |
| Product Description: | Mouse Monoclonal anti-LDB2 (1C2) |
| Clone: | 1C2 |
| Clonality: | Monoclonal |
| ListPrice: | 295 |
| Gene ID: | 9079 |
| Gene Symbol: | LDB2 |
| Omim ID: | 603450 |
| Immunogen: | LDB2 (AAH34019, 1 a.a. ~ 374 a.a) full length recombinant protein with GST tag. |
| Epitope: | MSSTPHDPFYSSPFGPFYRRHTPYMVQPEYRIYEMNKRLQSRTEDSDNLWWDAFATEFFEDDATLTLSFCLEDGPKRYT IGRTLIPRYFSTVFEGGVTDLYYILKHSKESYHNSSITVDCDQCTMVTQHGKPMFTKVCTEGRLILEFTFDDLMRIKTW HFTIRQYRELVPRSILAMHAQDPQVLDQLSKNITRMGLTNFTLNYLRLCVILEPMQELMSRHKTYNLSPRDCLKTCLFQ KWQRMVAPPAEPTRQPTT |
| Specificity: | LDB2 - LIM domain binding 2 |
| Cross Reactivity: | Human. Other species not tested. |
| Packaging: | 0.1 mg IgG purified Mouse ascites. |
| Uses: | Antibody reactive against cell lysate for Western Blot. Has also been used for immunofluoresence and ELISA. |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | IgG purified |
| Isotype: | IgG1 Kappa |
| Host Name: | Mouse |
| Application Summary: | ELISA, immunofluorescence, Western Blot |
| Species Summary: | Hu |
| Alternate Names: | anti-Carboxyl Terminal LIM Domain Protein 1 antibody, anti-CLIM 1 antibody, anti-LIM Domain Binding 2 antibody |
| Package Size: | 0.1 mg |
| Preservative: | No preservative |
order or more information: | company product webpage |