| request information: |
|
| Catalog Code: | H00009077-M01 |
| Product Name: | DIRAS3 Antibody |
| Product Description: | Mouse Monoclonal anti-DIRAS3 (1G4) |
| Clone: | 1G4 |
| Clonality: | Monoclonal |
| ListPrice: | 295 |
| Gene ID: | 9077 |
| Gene Symbol: | DIRAS3 |
| Omim ID: | 605193 |
| Immunogen: | DIRAS3 (NP_004666, 130 a.a. ~ 230 a.a) partial recombinant protein with GST tag. |
| Epitope: | FYELICKIKGNNLHKFPIVLVGNKSDDTHREVALNDGATCAMEWNCAFMEISAKTDVNVQELFHMLLNYKKKPTTGLQE
PEKKSQMPNTTEKLLDKCIIM* |
| Specificity: | DIRAS3 - DIRAS family, GTP-binding RAS-like 3 |
| Cross Reactivity: | Human. Other species not tested. |
| Packaging: | 0.1 mg IgG purified Mouse ascites. |
| Uses: | Antibody Reactive against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control. |
| Background: | This gene is a member of the ras superfamily, and is expressed in normal ovarian and breast epithelial cells but not in ovarian and breast cancers. It is a maternally imprinted gene and its expression is associated with growth suppression. Thus, this gene appears to be a putative tumor suppressor gene whose function is abrogated in ovarian and breast cancers. |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | IgG purified |
| Isotype: | IgM kappa |
| Host Name: | Mouse |
| Application Summary: | ELISA, Western Blot |
| Species Summary: | Hu |
| Alternate Names: | anti-ARHI antibody, anti-NOEY2 antibody |
| Package Size: | 0.1 mg |
| Preservative: | No preservative |
order or
more information: | company product webpage |