ExactAntigen

Mouse Polyclonal anti-DIRAS3
For more information about this product,
enter your email address here
or visit directly company product webpage
.
CatalogCode:H00009077-A01
ProductName:DIRAS3 Antibody
Product Description:Mouse Polyclonal anti-DIRAS3
Clonality:Polyclonal
Immunogen:DIRAS3 (NP_004666, 130 a.a. ~ 230 a.a) partial recombinant protein with GST tag.
Epitope:FYELICKIKGNNLHKFPIVLVGNKSDDTHREVALNDGATCAMEWNCAFMEISAKTDVNVQELFHMLLNYKKKPTTGLQEPEKKSQMPNTTEKLLDKCIIM* ...
Specificity:DIRAS3 - DIRAS family, GTP-binding RAS-like 3
CrossReactivity:Human. Other species not tested.
Packaging:0.05 ml of mouse antisera with 50% glycerol. No preservative.
Uses:The quality control of this antibody is limited to Western blot on the immunizing protein.
Abnova's recommended working dilutions for western analysis are as follows:
1:500 dilution for ascites
1:1000 for purified Ig
1:500-1:1000 for polysera
Background:This gene is a member of the ras superfamily, and is expressed in normal ovarian and breast epithelial cells but not in ovarian and breast cancers. It is a maternally imprinted gene and its expression is associated with growth suppression. Thus, this gene appears to be a putative tumor suppressor gene whose function is abrogated in ovarian and breast cancers.
Storage:Aliquot and store at -20C or -80C.  Avoid freeze-thaw cycles.
Purity:Whole antisera
Host_Name:Mouse
ListPrice:225
AppSummary:ELISA, WB
SpeciesSummary:Hu
ALTnames:anti-ARHI antibody, anti-NOEY2 antibody
ProteinTarget:DIRAS3 - DIRAS family, GTP-binding RAS-like 3
PackageSize:0.05 ml
NotesMain:This antibody is available only in North America and is supplied by Abnova If in stock in Taiwan. delivery is 10-14 days. If not in stock. lead times can be extended. We will inform you of any extended delays within 48 hours. The immunizing protein is also available for this product. Unit cost for the protein is $ 250 (2 ug). $ 305 (10 ug). and $ 445 (25 ug).
Gene_Id:9077
Gene_Symbol:DIRAS3
Omim_ID:605193 H00009077-M01
see all human ARHI antibodies
see anti mouse secondary antibodies


2008©ExactAntigen home | browse | about