ExactAntigen

CLDN1 Antibody | Novus Biologicals antibody product information
request information:
Catalog Code:H00009076-M01
Product Name:CLDN1 Antibody
Product Description:Mouse Monoclonal anti-CLDN1 (1C5-D9)
Clone:1C5-D9
Clonality:Monoclonal
ListPrice:295
Gene ID:9076
Gene Symbol:CLDN1
Omim ID:603718, 607626,
Immunogen:CLDN1 (AAH12471, 1 a.a. ~ 212 a.a) full length recombinant protein with GST tag.
Epitope:MANAGLQLLGFILAFLGWIGAIVSTALPQWRIYSYAGDNIVTAQAMYEGLWMSCVSQSTGQIQCKVFDSLLNLSSTLQA
TRALMVVGILLGVIAIFVATVGMKCMKCLEDDEVQKMRMAVIGGAIFLLAGLAILVATAWYGNRIVQEFYDPMTPVNAR
YEFGQALFTGWAAASLCLLGGALLCCSCPRKTTSYPTPRPYPKPAPSSGKDYV*
Specificity:CLDN1 - claudin 1
Cross Reactivity:Human. Other species not tested.
Packaging:0.1 mg IgG purified Mouse ascites.
Uses:Antibody reactive against cell lysate, transfected lysate and recombinant protein for Western Blot. Has also been used for immunohistochemistry (paraffin) and ELISA.
Background:Tight junctions represent one mode of cell-to-cell adhesion in epithelial or endothelial cell sheets, forming continuous seals around cells and serving as a physical barrier to prevent solutes and water from passing freely through the paracellular space. These junctions are comprised of sets of continuous networking strands in the outwardly facing cytoplasmic leaflet, with complementary grooves in the inwardly facing extracytoplasmic leaflet. The protein encoded by this gene, a member of the claudin family, is an integral membrane protein and a component of tight junction strands. Loss of function mutations result in neonatal ichthyosis-sclerosing cholangitis syndrome.
Storage:Aliquot and store at -20C or -80C.  Avoid freeze-thaw cycles.
Purity:IgG purified
Isotype:IgG2a Kappa
Host Name:Mouse
Application Summary:ELISA, Immunohistochemistry-Paraffin, Western Blot
Species Summary:Hu
Alternate Names:anti-CLD1 antibody, anti-ILVASC antibody, anti-SEMP1 antibody
Package Size:0.1 mg
Preservative:No preservative
Product References:Mee, CJ, et al. Effect of cell polarization on hepatitis C virus viral entry. J Virol. 2007 Oct 24;[Epub ahead of print].
Novus References:1. Harris HJ, Farquhar MJ, Mee CJ, et al. CD81 and Claudin 1 Coreceptor Association: Role in Hepatitis C Virus Entry. J Virol. May 15, 2008;82(10):5007-20. 2. Farquhar MJ, Harris HJ, Diskar M, et al. Protein Kinase A dependent step(s) in Hepatitis C virus entry and infectivity. J Virol 2008:JVI.00592-00508.
order or
more information
:
company product webpage
Also see:
all human CLDN1 antibodies


2008©ExactAntigen home | browse | about