| request information: |
|
| Catalog Code: | H00009068-M03 |
| Product Name: | ANGPTL1 Antibody |
| Product Description: | Mouse Monoclonal anti-ANGPTL1 (3A5) |
| Clone: | 3A5 |
| Clonality: | Monoclonal |
| ListPrice: | 295 |
| Gene ID: | 9068 |
| Gene Symbol: | ANGPTL1 |
| Omim ID: | 603874, |
| Immunogen: | ANGPTL1 (AAH50640, 24 a.a. ~ 492 a.a) full length recombinant protein with GST tag. |
| Epitope: | GQFKIKKINQRRYPRATDGKEEAKKCAYTFLVPEQRITGPICVNTKGQDASTIKDMITRMDLENLKDVLSRQKREIDVL
QLVVDVDGNIVNEVKLLRKESRNMNSRVTQLYMQLLHEIIRKRDNSLELSQLENKILNVTTEMLKMATRYRELEVKYAS
LTDLVNNQSVMITLLEEQCLRIFSRQDTHVSPPLVQVVPQHIPNSQQYTPGLLGGNEIQRDPGYPRDLMPPPDLATSPT
KSPFKIPPVTFINEGPFK |
| Cross Reactivity: | Human. Other species not tested. |
| Packaging: | 0.1 mg IgG purified Mouse ascites. |
| Uses: | Antibody reactive against recombinant protein on ELISA. It has also been used for immunohistochemistry on paraffin sections. |
| Background: | Angiopoietins are members of the vascular endothelial growth factor family and the only known growth factors largely specific for vascular endothelium. Angiopoietin-1, angiopoietin-2, and angiopoietin-4 participate in the formation of blood vessels. The protein encoded by this gene is another member of the angiopoietin family that is widely expressed in adult tissues with mRNA levels highest in highly vascularized tissues. This protein was found to be a secretory protein that does not act as an endothelial cell mitogen in vitro. |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | IgG purified |
| Isotype: | IgG2a Kappa |
| Host Name: | Mouse |
| Buffer: | In 1x PBS, pH 7.2 |
| Application Summary: | ELISA, Immunohistochemistry-Paraffin |
| Species Summary: | Hu |
| Alternate Names: | anti-ANG3 antibody, anti-ANGPT3 antibody, anti-ARP1 antibody, anti-AngY antibody, anti-KIAA0351 antibody, anti-UNQ162 antibody, anti-dJ595C2.2 antibody |
| Package Size: | 0.1 mg |
| Preservative: | No preservative |
order or
more information: | company product webpage |