| request information: |
|
| Catalog Code: | H00009061-A01 |
| Product Name: | PAPSS1 Antibody |
| Product Description: | Mouse Polyclonal anti-PAPSS1 |
| Clonality: | Polyclonal |
| ListPrice: | 225 |
| Gene ID: | 9061 |
| Gene Symbol: | PAPSS1 |
| Omim ID: | 603262, |
| Immunogen: | PAPSS1 (NP_005434, 144 a.a. ~ 253 a.a) partial recombinant protein with GST tag. |
| Epitope: | QIHEGASLPFFEVFVDAPLHVCEQRDVKGLYKKARAGEIKGFTGIDSEYEKPEAPELVLKTDSCDVNDCVQQVVELLQE
RDIVPVDASYEVKELYVPENKLHLAKTDAE* |
| Specificity: | PAPSS1 - 3'-phosphoadenosine 5'-phosphosulfate synthase 1 |
| Cross Reactivity: | Human. Other species not tested. |
| Packaging: | 0.05 ml of mouse antisera with 50% glycerol. No preservative. |
| Uses: | The quality control of this antibody is limited to Western blot on the immunizing protein. Abnovas recommended working dilutions for western analysis are as follows:1:500 dilution for ascites1:1000 for purified Ig1:500-1:1000 for polysera |
| Background: | Three-prime-phosphoadenosine 5-prime-phosphosulfate (PAPS) is the sulfate donor cosubstrate for all sulfotransferase (SULT) enzymes (Xu et al., 2000 [PubMed 10679223]). SULTs catalyze the sulfate conjugation of many endogenous and exogenous compounds, including drugs and other xenobiotics. In humans, PAPS is synthesized from adenosine 5-prime triphosphate (ATP) and inorganic sulfate by 2 isoforms, PAPSS1 and PAPSS2 (MIM 603005).[supplied by OMIM] |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | Whole antisera |
| Host Name: | Mouse |
| Application Summary: | ELISA, Western Blot |
| Species Summary: | Hu |
| Alternate Names: | anti-ATPSK1 antibody, anti-PAPSS antibody, anti-SK1 antibody |
| Package Size: | 0.05 ml |
| Preservative: | No preservative |
order or
more information: | company product webpage |