ExactAntigen

PAPSS1 Antibody | Novus Biologicals antibody product information
request information:
Catalog Code:H00009061-A01
Product Name:PAPSS1 Antibody
Product Description:Mouse Polyclonal anti-PAPSS1
Clonality:Polyclonal
ListPrice:225
Gene ID:9061
Gene Symbol:PAPSS1
Omim ID:603262,
Immunogen:PAPSS1 (NP_005434, 144 a.a. ~ 253 a.a) partial recombinant protein with GST tag.
Epitope:QIHEGASLPFFEVFVDAPLHVCEQRDVKGLYKKARAGEIKGFTGIDSEYEKPEAPELVLKTDSCDVNDCVQQVVELLQE
RDIVPVDASYEVKELYVPENKLHLAKTDAE*
Specificity:PAPSS1 - 3'-phosphoadenosine 5'-phosphosulfate synthase 1
Cross Reactivity:Human. Other species not tested.
Packaging:0.05 ml of mouse antisera with 50% glycerol. No preservative.
Uses:The quality control of this antibody is limited to Western blot on the immunizing protein. Abnovas recommended working dilutions for western analysis are as follows:1:500 dilution for ascites1:1000 for purified Ig1:500-1:1000 for polysera
Background:Three-prime-phosphoadenosine 5-prime-phosphosulfate (PAPS) is the sulfate donor cosubstrate for all sulfotransferase (SULT) enzymes (Xu et al., 2000 [PubMed 10679223]). SULTs catalyze the sulfate conjugation of many endogenous and exogenous compounds, including drugs and other xenobiotics. In humans, PAPS is synthesized from adenosine 5-prime triphosphate (ATP) and inorganic sulfate by 2 isoforms, PAPSS1 and PAPSS2 (MIM 603005).[supplied by OMIM]
Storage:Aliquot and store at -20C or -80C.  Avoid freeze-thaw cycles.
Purity:Whole antisera
Host Name:Mouse
Application Summary:ELISA, Western Blot
Species Summary:Hu
Alternate Names:anti-ATPSK1 antibody, anti-PAPSS antibody, anti-SK1 antibody
Package Size:0.05 ml
Preservative:No preservative
order or
more information
:
company product webpage
Also see:
all human PAPSS1 antibodies


2008©ExactAntigen home | browse | about