| request information: |
|
| Catalog Code: | H00009055-M01 |
| Product Name: | PRC1 Antibody |
| Product Description: | Mouse Monoclonal anti-PRC1 (3E3-1G1) |
| Clone: | 3E3-1G1 |
| Clonality: | Monoclonal |
| ListPrice: | 295 |
| Gene ID: | 9055 |
| Gene Symbol: | PRC1 |
| Omim ID: | 603484 |
| Immunogen: | PRC1 (AAH03138, 1 a.a. ~ 621 a.a) full length recombinant protein with GST tag. |
| Epitope: | MRRSEVLAEESIVCLQKALNHLREIWELIGIPEDQRLQRTEV VKKHIKELLDMMIAEEESLKERLIKSISVCQKELNTLCSELH VEPFQEEGETTILQLEKDLRTQVELMRKQKKERKQELKLLQE QDQELCEILCMPHYDIDSASVPSLEELNQFRQHVTTLRETKA SRREEFVSIKRQIILCMEELDHTPDTSFERDVVCEDEDAFCL SLENIATLQKLLRQLEMQKSQNEAVCEGLRTQIRE |
| Specificity: | PRC1 - protein regulator of cytokinesis 1 |
| Cross Reactivity: | Human. Other species not tested. |
| Packaging: | 0.1 mg IgG purified Mouse ascites. |
| Uses: | Antibody Reactive against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control. |
| Localization: | Nuclear, depending on the phase of the cell cycle. |
| Background: | This gene encodes a protein that is involved in cytokinesis. The encoded protein is at high level during S and G2/M and drop dramatically after cell exit mitosis and enter G1. It is located in the nucleus during interphase, and becomes associated with mitotic spindles in a highly dynamic manner during mitosis, and localizes to the cell mid-body during cytokinesis. This protein has been shown to be a substrate of several cyclin-dependent kinases (CDKs). At least three alternatively spliced transcript variants encoding distinct isoforms have been observed. |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | IgG purified |
| Isotype: | IgG1 kappa |
| Host Name: | Mouse |
| Buffer: | Phosphate buffered saline, pH 7.2 |
| Application Summary: | ELISA, Western Blot |
| Species Summary: | Hu |
| Alternate Names: | anti-Anaphase spindle elongation 1 homolog (S. cerevisiae) antibody, anti-Anaphase spindle elongation 1 homolog antibody, anti-ASE 1 antibody, anti-ASE1 antibody, anti-MGC1671 antibody, anti-MGC3669 antibody, anti-PRC 1 antibody, anti-Protein regulating cytokinesis 1 antibody, anti-Protein regulator of cytokinesis 1 antibody |
| Package Size: | 0.1 mg |
| Preservative: | No preservative |
order or
more information: | company product webpage |