ExactAntigen

BAZ1B Antibody
For more information about this product,
enter your email address here
or visit directly company product webpage
.
Catalog Code:H00009031-M01
Product Type:Primary Antibody
Product Name:BAZ1B Antibody
List Price:275
Clonality:Monoclonal
Gene ID:9031
Host:Mouse
Clone:5E9
Isotype:IgG2a Kappa
Product Description:Mouse Monoclonal anti-BAZ1B (5E9)
Cross Reactivity:Human. Other species not tested.
Species Summary:Hu
Background:NCBI Entrez Gene ID = BAZ1B PLEASE NOTE - This product originates in Taiwan. If in stock in Taiwan, delivery is 10-14 days. If not in stock, lead times can be extended. We will inform you of any extended delays within 48 hours.This gene encodes a
Alternate Names:anti-WBSCR10 antibody, anti-WBSCR9 antibody, anti-WSTF antibody
Immunogen:BAZ1B (NP_075381, 1384 a.a. ~ 1484 a.a) partial recombinant protein with GST tag.
Epitope:MDFQTVQNKCSCGSYRSVQEFLTDMKQVFTNAEVYNCRGSHVLSCMVKTEQCLVALLHKHLPGHPYVRRKRKKFPDRLAEDEGDSEPEAVGQSRGRRQKK* ...
Specificity:BAZ1B - bromodomain adjacent to zinc finger domain, 1B
Purity:IgG purified
Packaging:100 ug purified IgG
Package Size:0.1 ml
Uses:Antibody reactive against recombinant protein on ELISA.
Application Summary:ELISA
Notes Main:This antibody is available only in North America and is supplied by Abnova The immunizing protein is also available for this product. Unit cost for the protein is $ 235 (2 ug), $ 285 (10 ug), and $ 425 (25 ug).
Gene Symbol:BAZ1B
Omim ID:605681
see all human BAZ1B antibodies
see anti mouse secondary antibodies


2008©ExactAntigen home | browse | about