| CatalogCode: | H00009031-A01 |
| ProductName: | BAZ1B Antibody |
| Product Description: | Mouse Polyclonal anti-BAZ1B |
| Clonality: | Polyclonal |
| Immunogen: | BAZ1B (NP_075381, 1384 a.a. ~ 1484 a.a) partial recombinant protein with GST tag. |
| Epitope: | MDFQTVQNKCSCGSYRSVQEFLTDMKQVFTNAEVYNCRGSHVLSCMVKTEQCLVALLHKHLPGHPYVRRKRKKFPDRLAEDEGDSEPEAVGQSRGRRQKK* ... |
| Specificity: | BAZ1B - bromodomain adjacent to zinc finger domain, 1B |
| CrossReactivity: | Human. Other species not tested. |
| Packaging: | 0.05 ml of mouse antisera with 50% glycerol. No preservative. |
| Uses: | The quality control of this antibody is limited to Western blot on the immunizing protein and cell lysates. Abnova's recommended working dilutions for western analysis are as follows:
1:500-1:1000 for polysera |
| Background: | This gene encodes a member of the bromodomain protein family. The bromodomain is a structural motif characteristic of proteins involved in chromatin-dependent regulation of transcription. This gene is deleted in Williams-Beuren syndrome, a developmental disorder caused by deletion of multiple genes at 7q11.23. |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | Whole antisera |
| Host_Name: | Mouse |
| ListPrice: | 225 |
| AppSummary: | ELISA, WB |
| SpeciesSummary: | Hu |
| ALTnames: | anti-WBSCR10 antibody, anti-WBSCR9 antibody, anti-WSTF antibody |
| ProteinTarget: | BAZ1B - bromodomain adjacent to zinc finger domain, 1B |
| PackageSize: | 0.05 ml |
| NotesMain: | This antibody is available only in North America and is supplied by Abnova If in stock in Taiwan. delivery is 10-14 days. If not in stock. lead times can be extended. We will inform you of any extended delays within 48 hours. The immunizing protein is also available for this product. Unit cost for the protein is $ 250 (2 ug). $ 305 (10 ug). and $ 445 (25 ug). |
| Gene_Id: | 9031 |
| Gene_Symbol: | BAZ1B |
| Omim_ID: | 605681 H00009031-M01 |