| request information: |
|
| Catalog Code: | H00009021-M02 |
| Product Name: | SOCS3 Antibody |
| Product Description: | Mouse Monoclonal anti-SOCS3 (1E4) |
| Clone: | 1E4 |
| Clonality: | Monoclonal |
| ListPrice: | 295 |
| Gene ID: | 9021 |
| Gene Symbol: | SOCS3 |
| Omim ID: | 604176, |
| Immunogen: | SOCS3 (AAH60858, 1 a.a. ~ 226 a.a) full length recombinant protein with GST tag. |
| Epitope: | MVTHSKFPAAGMSRPLDTSLRLKTFSSKSEYQLVVNAVRKLQESGFYWSAVTGGEANLLLSAEPAGTFLIRDSSDQRHF
FTLSVKTQSGTKNLRIQCEGGSFSLQSDPRSTQPVPRFDCVLKLVHHYMPPPGAPSFPSPPTEPSSEVPEQPSAQPLPG
SPPRRAYYIYSGGEKIPLVLSRPLSSNVATLQHLCRKTVNGHLDSYEKVTQLPGPIREFLDQYDAPL* |
| Cross Reactivity: | Human. Other species not tested. |
| Packaging: | 0.1 mg IgG purified Mouse ascites. |
| Uses: | Antibody reactive against recombinant protein on ELISA. It has also been used for immunohistochemistry on paraffin sections. |
| Background: | This gene encodes a member of the STAT-induced STAT inhibitor (SSI), also known as suppressor of cytokine signaling (SOCS), family. SSI family members are cytokine-inducible negative regulators of cytokine signaling. The expression of this gene is induced by various cytokines, including IL6, IL10, and interferon (IFN)-gamma. The protein encoded by this gene can bind to JAK2 kinase, and inhibit the activity of JAK2 kinase. Studies of the mouse counterpart of this gene suggested the roles of this gene in the negative regulation of fetal liver hematopoiesis, and placental development. |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | IgG purified |
| Isotype: | IgG2b Kappa |
| Host Name: | Mouse |
| Buffer: | In 1x PBS, pH 7.2 |
| Application Summary: | ELISA, Immunohistochemistry-Paraffin |
| Species Summary: | Hu |
| Alternate Names: | anti-CIS3 antibody, anti-Cish3 antibody, anti-MGC71791 antibody, anti-SOCS-3 antibody, anti-SSI-3 antibody |
| Package Size: | 0.1 mg |
| Preservative: | No preservative |
order or
more information: | company product webpage |