ExactAntigen

TAF1A Antibody
For more information about this product,
enter your email address here
or visit directly company product webpage
.
Catalog Code:H00009015-M01
Product Type:Primary Antibody
Product Name:TAF1A Antibody
List Price:275
Clonality:Monoclonal
Gene ID:9015
Host:Mouse
Clone:1F8
Isotype:IgG2a Kappa
Product Description:Mouse Monoclonal anti-TAF1A (1F8)
Cross Reactivity:Human. Other species not tested.
Species Summary:Hu
Background:NCBI Entrez Gene ID = TAF1A PLEASE NOTE - This product originates in Taiwan. If in stock in Taiwan, delivery is 10-14 days. If not in stock, lead times can be extended. We will inform you of any extended delays within 48 hours.
Alternate Names:anti-MGC:17061 antibody, anti-RAFI48 antibody, anti-SL1 antibody, anti-TAFI48 antibody
Immunogen:TAF1A (NP_005672, 1 a.a. ~ 101 a.a) partial recombinant protein with GST tag.
Epitope:MSDFSEELKGPVTDDEEVETSVLSGAGMHFPWLQTYVETVAIGGKRRKDFAQTTSACLSFIQEALLKHQWQQAAEYMYSYFQTLEDSDSYKRQAAPEIIW* ...
Specificity:TAF1A - TATA box binding protein (TBP)-associated factor, RNA polymerase I, A, 48kDa
Purity:IgG purified
Packaging:100 ug purified IgG
Package Size:0.1 ml
Uses:Antibody Reactive against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control.
Application Summary:ELISA, WB
Notes Main:This antibody is available only in North America and is supplied by Abnova The immunizing protein is also available for this product. Unit cost for the protein is $ 235 (2 ug), $ 285 (10 ug), and $ 425 (25 ug).
Gene Symbol:TAF1A
Omim ID:604903
see all human TAF1A antibodies
see anti mouse secondary antibodies


2008©ExactAntigen home | browse | about