| request information: | |
| Catalog Code: | H00008942-M02 |
| Product Name: | KYNU Antibody |
| Product Description: | Mouse Monoclonal anti-KYNU (1G2) |
| Clone: | 1G2 |
| Clonality: | Monoclonal |
| ListPrice: | 295 |
| Gene ID: | 8942 |
| Gene Symbol: | KYNU |
| Omim ID: | 236800, |
| Immunogen: | KYNU (NP_003928, 2 a.a. ~ 109 a.a) partial recombinant protein with GST tag. |
| Epitope: | EPSSLELPADTVQRIAAELKCHPTDERVALHLDEEDKLRHFRECFYIPKIQDLPPVDLSLVNKDENAIYFLGNSLGLQP KMVKTYLEEELDKWAKIAAYGHEVGKRP* |
| Cross Reactivity: | Human. Other species not tested. |
| Packaging: | 0.1 mg IgG purified Mouse ascites. |
| Uses: | Antibody Reactive against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control. |
| Background: | Kynureninase is a pyridoxal-5'-phosphate (pyridoxal-P) dependent enzyme that catalyzes the cleavage of L-kynurenine and L-3-hydroxykynurenine into anthranilic and 3-hydroxyanthranilic acids, respectively. Kynureninase is involved in the biosynthesis of NAD cofactors from tryptophan through the kynurenine pathway. Two transcript variants encoding different isoforms have been found for this gene. |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | IgG purified |
| Isotype: | IgG2a Lambda |
| Host Name: | Mouse |
| Buffer: | In 1x PBS, pH 7.2 |
| Application Summary: | ELISA, Western Blot |
| Species Summary: | Hu |
| Package Size: | 0.1 mg |
| Preservative: | No preservative |
order or more information: | company product webpage |