| request information: |
|
| Catalog Code: | H00008907-A01 |
| Product Name: | adaptor-related protein complex 1, mu 1 subunit Antibody |
| Product Description: | Mouse Polyclonal anti-adaptor-related protein complex 1, mu 1 subunit |
| Clonality: | Polyclonal |
| ListPrice: | 225 |
| Gene ID: | 8907 |
| Gene Symbol: | AP1M1 |
| Omim ID: | 603535, |
| Immunogen: | AP1M1 (NP_115882, 1 a.a. ~ 75 a.a) partial recombinant protein with GST tag. |
| Epitope: | MSASAVYVLDLKGKVLICRNYRGDVDMSEVEHFMPILMEKEEEGMLSPILAHGGVRFMWIKHNNLYLVATSKKN* |
| Specificity: | adaptor-related protein complex 1, mu 1 subunit |
| Cross Reactivity: | Human. Other species not tested. |
| Packaging: | 0.05 ml of mouse antisera with 50% glycerol. |
| Uses: | Antibody reactive against cell lysate and recombinant protein for western blot. It has also been used for ELISA. |
| Background: | The protein encoded by this gene is the medium chain of the trans-Golgi network clathrin-associated protein complex AP-1. The other components of this complex are beta-prime-adaptin, gamma-adaptin, and the small chain AP1S1. This complex is located at the Golgi vesicle and links clathrin to receptors in coated vesicles. These vesicles are involved in endocytosis and Golgi processing. |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Host Name: | Mouse |
| Application Summary: | ELISA, Western Blot |
| Species Summary: | Hu |
| Alternate Names: | anti-AP47 antibody, anti-CLAPM2 antibody, anti-CLTNM antibody, anti-MU-1A antibody |
| Package Size: | 0.05 ml |
| Preservative: | No preservative |
order or
more information: | company product webpage |