| request information: |
|
| Catalog Code: | H00008904-M01 |
| Product Name: | CPNE1 Antibody |
| Product Description: | Mouse Monoclonal anti-CPNE1 (8B8) |
| Clone: | 8B8 |
| Clonality: | Monoclonal |
| ListPrice: | 295 |
| Gene ID: | 8904 |
| Gene Symbol: | CPNE1 |
| Omim ID: | 604205, |
| Immunogen: | CPNE1 (NP_003906, 111 a.a. ~ 211 a.a) partial recombinant protein with GST tag. |
| Epitope: | TLPLMLKPGKPAGRGTITVSAQELKDNRVVTMEVEARNLDKKDFLGKSDPFLEFFRQGDGKWHLVYRSEVIKNNLNPTW
KRFSVPVQHFCGGNPSTPIQV* |
| Specificity: | CPNE1 - copine I |
| Cross Reactivity: | Human. Other species not tested. |
| Packaging: | 0.1 mg IgG purified Mouse ascites. |
| Uses: | Antibody reactive against cell lysate and recombinant protein for western blot. It has also been used for RNAi validation and ELISA. |
| Background: | Calcium-dependent membrane-binding proteins may regulate molecular events at the interface of the cell membrane and cytoplasm. This gene encodes a calcium-dependent protein that also contains two N-terminal type II C2 domains and an integrin A domain-like sequence in the C-terminus. However, the encoded protein does not contain a predicted signal sequence or transmembrane domains. This protein has a broad tissue distribution and it may function in membrane trafficking. This gene and the gene for RNA binding motif protein 12 overlap at map location 20q11.21. Sequence analysis identified multiple alternatively spliced variants in the 5' UTR. All variants encode the same protein. |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | IgG purified |
| Isotype: | IgG2a Kappa |
| Host Name: | Mouse |
| Application Summary: | ELISA, Western Blot, RNAi Validation |
| Species Summary: | Hu |
| Alternate Names: | anti-COPN1 antibody, anti-CPN1 antibody, anti-MGC1142 antibody |
| Package Size: | 0.1 mg |
| Preservative: | No preservative |
order or
more information: | company product webpage |