ExactAntigen

CCNA1 Antibody
For more information about this product,
enter your email address here
or visit directly company product webpage
.
Catalog Code:H00008900-M02
Product Type:Primary Antibody
Product Name:CCNA1 Antibody
List Price:275
Clonality:Monoclonal
Gene ID:8900
Host:Mouse
Clone:4A11-5B5
Isotype:IgG1 Kappa
Product Description:Mouse Monoclonal anti-CCNA1 - cyclin A1 (4A11-5B5)
Cross Reactivity:Human. Other species not tested.
Species Summary:Hu
Background:The protein encoded by this gene belongs to the highly conserved cyclin family, whose members are characterized by a dramatic periodicity in protein abundance through the cell cycle. Cyclins function as regulators of CDK kinases. Different cyclins exhibit
Immunogen:CCNA1 (AAH36346, 1 a.a. ~ 465 a.a) full length recombinant protein with GST tag.
Epitope:METGFPAIMYPGSFIGGWGEEYLSWEGPGLPDFVFQQPVESEAMHCSNPKSGVVLATVARGPDACQILTRAPLGQDPPQRTVLGLLTANGQYRRTCGQGITRIRCYSGSENAFPPAGKKALPDCGVQEPPKQGFDIYMDELEQGDRDSCSVREGMAFEDVYEVDTGTLKSDLHFLLDFNTVSPMLVDSSLLSQSEDISSLGTDVINVTEYAEEIYQYLREAEIRHRPKAHYMKKQPDITEGMRTILVDWLVEVGE ...
Purity:IgG purified
Buffer:In 1x PBS, pH 7.2
Packaging:0.1 mg IgG purified Mouse ascites.
Package Size:0.1 mg
Uses:Antibody Reactive Against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control.
Application Summary:ELISA, WB
Notes Main:This antibody is available only in North America and is supplied by Abnova If in stock in Taiwan. delivery is 10-14 days. If not in stock. lead times can be extended. We will inform you of any extended delays within 48 hours. The immunizing protein is
Gene Symbol:CCNA1
see all human CCNA1 antibodies
see anti mouse secondary antibodies


2008©ExactAntigen home | browse | about