| request information: |
|
| Catalog Code: | H00008888-M01 |
| Product Name: | MCM3 minichromosome maintenance deficient 3 associated protein Antibody |
| Product Description: | Mouse Monoclonal anti-MCM3 minichromosome maintenance deficient 3 associated protein (1H3) |
| Clone: | 1H3 |
| Clonality: | Monoclonal |
| ListPrice: | 295 |
| Gene ID: | 8888 |
| Gene Symbol: | MCM3AP |
| Omim ID: | 603294, |
| Immunogen: | MCM3AP (AAH13285, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag. |
| Epitope: | VRVARCCEDVCAHLVDLFLVEEIFQTAKETLQELQCFCKYLQRWREAVTARKKLRRQMRAFPAAPCCVDVSDRLRALAP
SAECPIAEENLARGLLDLGHA |
| Specificity: | MCM3 minichromosome maintenance deficient 3 (S. cerevisiae) associated protein |
| Cross Reactivity: | Human. Other species not tested. |
| Packaging: | 0.1 mg IgG purified Mouse ascites. |
| Uses: | Antibody reactive against recombinant protein on ELISA. |
| Background: | The minichromosome maintenance protein 3 (MCM3) is one of the MCM proteins essential for the initiation of DNA replication. The protein encoded by this gene is a MCM3 binding protein. It was reported to have phosphorylation-dependent DNA-primase activity, which was up-regulated in antigen immunization induced germinal center. This protein was demonstrated to be an acetyltransferase that acetylates MCM3 and plays a role in DNA replication. The mutagenesis of a nuclear localization signal of MCM3 affects the binding of this protein with MCM3, suggesting that this protein may also facilitate MCM3 nuclear localization. |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | IgG purified |
| Isotype: | IgG2a Kappa |
| Host Name: | Mouse |
| Buffer: | 1X PBS pH 7.2 |
| Application Summary: | ELISA |
| Species Summary: | Hu |
| Alternate Names: | anti-GANP antibody, anti-KIAA0572 antibody, anti-MAP80 antibody |
| Package Size: | 0.1 mg |
| Preservative: | No preservative |
order or
more information: | company product webpage |