ExactAntigen

FUBP1 Antibody
For more information about this product,
enter your email address here
or visit directly company product webpage
.
Catalog Code:H00008880-M01
Product Type:Primary Antibody
Product Name:FUBP1 Antibody
List Price:275
Clonality:Monoclonal
Gene ID:8880
Host:Mouse
Clone:3H4
Isotype:IgG2a Kappa
Product Description:Mouse Monoclonal anti-FUBP1 (3H4)
Cross Reactivity:Human. Other species not tested.
Species Summary:Hu
Background:This gene encodes a ssDNA binding protein that activates the far upstream element (FUSE) of c-myc and stimulates expression of c-myc in undifferentiated cells. Regulation of FUSE by FUBP occurs through single-strand binding of FUBP to the non-coding stran
Alternate Names:anti-FBP antibody, anti-FUBP antibody
Immunogen:FUBP1 (NP_003893, 27 a.a. ~ 137 a.a) partial recombinant protein with GST tag.
Epitope:VNDAFKDALQRARQIAAKIGGDAGTSLNSNDYGYGGQKRPLEDGDQPDAKKVAPQNDSFGTQLPPMHQQQSRSVMTEEYKVPDGMVGFIIGRGGEQISRIQQESGCKIQI* ...
Specificity:FUBP1 - far upstream element (FUSE) binding protein 1
Purity:IgG purified
Packaging:0.1 ml IgG purified Mouse ascites.
Package Size:0.1 ml
Uses:Antibody Reactive against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control. This antibody has also been used in Immunohistochemistry of paraffin embedded sections.
Application Summary:ELISA, WB, IHC-P
Notes Main:This antibody is available only in North America and is supplied by Abnova The immunizing protein is also available for this product. Unit cost for the protein is $ 235 (2 ug), $ 285 (10 ug), and $ 425 (25 ug).
Gene Symbol:FUBP1
Omim ID:603444,
see all human far upstream element binding protein antibodies
see anti mouse secondary antibodies


2008©ExactAntigen home | browse | about