| Catalog Code: | H00008880-A01 |
| Product Type: | Primary Antibody |
| Product Name: | FUBP1 Antibody |
| List Price: | 205 |
| Clonality: | Polyclonal |
| Gene ID: | 8880 |
| Host: | Mouse |
| Product Description: | Mouse Polyclonal anti-FUBP1 |
| Cross Reactivity: | Human. Other species not tested. |
| Species Summary: | Hu |
| Background: | This gene encodes a ssDNA binding protein that activates the far upstream element (FUSE) of c-myc and stimulates expression of c-myc in undifferentiated cells. Regulation of FUSE by FUBP occurs through single-strand binding of FUBP to the non-coding stran |
| Alternate Names: | anti-FBP antibody, anti-FUBP antibody |
| Immunogen: | FUBP1 (NP_003893, 27 a.a. ~ 137 a.a) partial recombinant protein with GST tag. |
| Epitope: | VNDAFKDALQRARQIAAKIGGDAGTSLNSNDYGYGGQKRPLEDGDQPDAKKVAPQNDSFGTQLPPMHQQQSRSVMTEEYKVPDGMVGFIIGRGGEQISRIQQESGCKIQI* ... |
| Specificity: | FUBP1 - far upstream element (FUSE) binding protein 1 |
| Purity: | Whole antisera |
| Packaging: | 50 ul Whole antisera Mouse antisera. |
| Package Size: | 50 ul |
| Uses: | The quality control of this antibody is limited to Western blot on the immunizing protein. <br>Abnova's recommended working dilutions for western analysis are as follows:<br>1:500 dilution for ascites<br>1:1000 for purified Ig<b |
| Application Summary: | ELISA, WB |
| Notes Main: | This antibody is available only in North America and is supplied by Abnova The immunizing protein is also available for this product. Unit cost for the protein is $ 235 (2 ug), $ 285 (10 ug), and $ 425 (25 ug). |
| Gene Symbol: | FUBP1 |
| Omim ID: | 603444 |