ExactAntigen

FUBP1 Antibody
For more information about this product,
enter your email address here
or visit directly company product webpage
.
Catalog Code:H00008880-A01
Product Type:Primary Antibody
Product Name:FUBP1 Antibody
List Price:205
Clonality:Polyclonal
Gene ID:8880
Host:Mouse
Product Description:Mouse Polyclonal anti-FUBP1
Cross Reactivity:Human. Other species not tested.
Species Summary:Hu
Background:This gene encodes a ssDNA binding protein that activates the far upstream element (FUSE) of c-myc and stimulates expression of c-myc in undifferentiated cells. Regulation of FUSE by FUBP occurs through single-strand binding of FUBP to the non-coding stran
Alternate Names:anti-FBP antibody, anti-FUBP antibody
Immunogen:FUBP1 (NP_003893, 27 a.a. ~ 137 a.a) partial recombinant protein with GST tag.
Epitope:VNDAFKDALQRARQIAAKIGGDAGTSLNSNDYGYGGQKRPLEDGDQPDAKKVAPQNDSFGTQLPPMHQQQSRSVMTEEYKVPDGMVGFIIGRGGEQISRIQQESGCKIQI* ...
Specificity:FUBP1 - far upstream element (FUSE) binding protein 1
Purity:Whole antisera
Packaging:50 ul Whole antisera Mouse antisera.
Package Size:50 ul
Uses:The quality control of this antibody is limited to Western blot on the immunizing protein. <br>Abnova's recommended working dilutions for western analysis are as follows:<br>1:500 dilution for ascites<br>1:1000 for purified Ig<b
Application Summary:ELISA, WB
Notes Main:This antibody is available only in North America and is supplied by Abnova The immunizing protein is also available for this product. Unit cost for the protein is $ 235 (2 ug), $ 285 (10 ug), and $ 425 (25 ug).
Gene Symbol:FUBP1
Omim ID:603444
see all human far upstream element binding protein antibodies
see anti mouse secondary antibodies


2008©ExactAntigen home | browse | about