ExactAntigen

vanin 1 Antibody
For more information about this product,
enter your email address here
or visit directly company product webpage
.
Catalog Code:H00008876-M05
Product Type:Primary Antibody
Product Name:vanin 1 Antibody
List Price:275
Clonality:Monoclonal
Gene ID:8876
Host:Mouse
Clone:2B10
Isotype:IgG2a Kappa
Product Description:Mouse Monoclonal anti-vanin 1 (2B10)
Cross Reactivity:Human. Other species not tested.
Species Summary:Hu
Background:Genbank acession number is NM_004666. PLEASE NOTE - This product originates in Taiwan. If in stock in Taiwan. delivery is 10-14 days. If not in stock. lead times can be extended. We will inform you of any extended delays within 48 hours.
Alternate Names:anti-MGC116930 antibody, anti-MGC116931 antibody, anti-MGC116932 antibody, anti-MGC116933 antibody, anti-Tiff66 antibody
Immunogen:VNN1 (NP_004657, 298 a.a. ~ 398 a.a) partial recombinant protein with GST tag.
Epitope:KLLLSQLDSHPSHSAVVNWTSYASSIEALSSGNKEFKGTVFFDEFTFVKLTGVAGNYTVCQKDLCCHLSYKMSENIPNEVYALGAFDGLHTVEGRYYLQI* ...
Specificity:vanin 1
Purity:IgG purified
Buffer:1X PBS pH 7.2
Packaging:100 ug purified IgG
Package Size:0.1 ml
Uses:Antibody reactive against recombinant protein on ELISA.
Application Summary:ELISA
Notes Main:This antibody is available only in North America and is supplied by Abnova The immunizing protein is also available for this product. Unit cost for the protein is $ 235 (2 ug). $ 285 (10 ug). and $ 425 (25 ug).
Gene Symbol:VNN1
Omim ID:603570,
see all human vanin 1 antibodies
see anti mouse secondary antibodies


2008©ExactAntigen home | browse | about