| CatalogCode: | H00008859-M01 |
| ProductName: | STK19 Antibody |
| Product Description: | Mouse Monoclonal anti-STK19 (4E11) |
| Clone: | 4E11 |
| Clonality: | Monoclonal |
| Immunogen: | STK19 (NP_004188, 255 a.a. ~ 365 a.a) partial recombinant protein with GST tag. |
| Epitope: | QMTQTFGFRDSEITHLVNAGVLTVRDAGSWWLAVPGAGRFIKYFVKGRQAVLSMVRKAKYRELLLSELLGRRAPVVVRLGLTYHVHDLIGAQLVDCISTTSGTLLRLPET* ... |
| Specificity: | STK19 - serine/threonine kinase 19 |
| CrossReactivity: | Human. Other species not tested. |
| Packaging: | 0.1 mg IgG purified Mouse ascites. |
| Uses: | Antibody reactive against recombinant protein on ELISA. The antibody is also shown to be specific in Western blot against cell lysates. |
| Background: | This gene encodes a serine/threonine kinase which localizes predominantly to the nucleus. Its specific function is unknown; it is possible that phosphorylation of this protein is involved in transcriptional regulation. This gene localizes to the major histocompatibility complex (MHC) class III region on chromosome 6 and expresses two transcript variants. |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | IgG purified |
| Isotype: | IgG2a Kappa |
| Host_Name: | Mouse |
| ListPrice: | 295 |
| AppSummary: | ELISA, WB |
| SpeciesSummary: | Hu |
| ALTnames: | anti-D6S60 antibody, anti-D6S60E antibody, anti-G11 antibody, anti-HLA-RP1 antibody, anti-RP1 antibody |
| ProteinTarget: | STK19 - serine/threonine kinase 19 |
| PackageSize: | 0.1 mg |
| NotesMain: | This antibody is available only in North America and is supplied by Abnova If in stock in Taiwan. delivery is 10-14 days. If not in stock. lead times can be extended. We will inform you of any extended delays within 48 hours. The immunizing protein is also available for this product. Unit cost for the protein is $ 250 (2 ug). $ 305 (10 ug). and $ 445 (25 ug). |
| Gene_Id: | 8859 |
| Gene_Symbol: | STK19 |
| Omim_ID: | 604977 H00008859-B01 |
order or
more information: | company product webpage |
| request information: |
|