| Catalog Code: | H00008859-B01 |
| Product Type: | Primary Antibody |
| Product Name: | STK19 Antibody |
| List Price: | 295 |
| Clonality: | Polyclonal |
| Gene ID: | 8859 |
| Host: | Mouse |
| Product Description: | Mouse Polyclonal anti-STK19 - serine/threonine kinase 19, MaxPab Antibody |
| Cross Reactivity: | Human. |
| Species Summary: | Hu(+) |
| Background: | This gene encodes a serine/threonine kinase which localizes predominantly to the nucleus. Its specific function is unknown; it is possible that phosphorylation of this protein is involved in transcriptional regulation. This gene localizes to the major histocompatibility complex (MHC) class III region on chromosome 6 and expresses two transcript variants. |
| Alternate Names: | anti-D6S60 antibody, anti-D6S60E antibody, anti-G11 antibody, anti-HLA-RP1 antibody, anti-MGC117388 antibody, anti-RP1 antibody |
| Immunogen: | STK19 (-, 1 a.a. ~ 364 a.a) full-length human protein. |
| Epitope: | MQKWFSAFDDAIIQRQWRANPSRGGGGVSFTKEVDTNVATGAPPRRQRVPGRACPWREPIRGRRGARPGGGDAGGTPGETVRHCSAPEDPIFRFSSLHSYPFPGTIKSRDMSWKRHHLIPETFGVKRRRKRGPVESDPLRGEPGSARAAVSELMQLFPRGLFEDALPPIVLRSQVYSLVPDRTVADRQLKELQEQGEIRIVQLGFDLDAHGIIFTEDYRTRVLKACDGRPYAGAVQKFLASVLPACGDLSFQQDQ ... |
| Preservative: | No Preservative |
| Packaging: | 0.05 ml of mouse antisera with 50% glycerol. |
| PackageSize: | 0.05 ml |
| Uses: | Antibody Reactive Against Recombinant Protein with GST tag on ELISA and Western Blot and also on transfected lysate in western blot. GST tag alone is used as a negative control. |
| Application Summary: | Western Blot 1:500, ELISA |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| WebLink: | www.novusbio.com/data_sheet/index ... |