ExactAntigen

STK19 Antibody
For more information about this product,
enter your email address here
or visit directly company product webpage
.
Catalog Code:H00008859-B01
Product Type:Primary Antibody
Product Name:STK19 Antibody
List Price:295
Clonality:Polyclonal
Gene ID:8859
Host:Mouse
Product Description:Mouse Polyclonal anti-STK19 - serine/threonine kinase 19, MaxPab Antibody
Cross Reactivity:Human.
Species Summary:Hu(+)
Background:This gene encodes a serine/threonine kinase which localizes predominantly to the nucleus. Its specific function is unknown; it is possible that phosphorylation of this protein is involved in transcriptional regulation. This gene localizes to the major histocompatibility complex (MHC) class III region on chromosome 6 and expresses two transcript variants.
Alternate Names:anti-D6S60 antibody, anti-D6S60E antibody, anti-G11 antibody, anti-HLA-RP1 antibody, anti-MGC117388 antibody, anti-RP1 antibody
Immunogen:STK19 (-, 1 a.a. ~ 364 a.a) full-length human protein.
Epitope:MQKWFSAFDDAIIQRQWRANPSRGGGGVSFTKEVDTNVATGAPPRRQRVPGRACPWREPIRGRRGARPGGGDAGGTPGETVRHCSAPEDPIFRFSSLHSYPFPGTIKSRDMSWKRHHLIPETFGVKRRRKRGPVESDPLRGEPGSARAAVSELMQLFPRGLFEDALPPIVLRSQVYSLVPDRTVADRQLKELQEQGEIRIVQLGFDLDAHGIIFTEDYRTRVLKACDGRPYAGAVQKFLASVLPACGDLSFQQDQ ...
Preservative:No Preservative
Packaging:0.05 ml of mouse antisera with 50% glycerol.
PackageSize:0.05 ml
Uses:Antibody Reactive Against Recombinant Protein with GST tag on ELISA and Western Blot and also on transfected lysate in western blot. GST tag alone is used as a negative control.
Application Summary:Western Blot 1:500, ELISA
Storage:Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
WebLink:www.novusbio.com/data_sheet/index ...
see all human STK19 antibodies
see anti mouse secondary antibodies


2008©ExactAntigen home | browse | about