ExactAntigen

NR1I2 Antibody
For more information about this product,
enter your email address here
or visit directly company product webpage
.
Catalog Code:H00008856-A01
Product Type:Primary Antibody
Product Name:NR1I2 Antibody
List Price:205
Clonality:Polyclonal
Gene ID:8856
Host:Mouse
Product Description:Mouse Polyclonal anti-NR1I2
Cross Reactivity:Human. Other species not tested.
Species Summary:Hu
Background:NCBI Entrez Gene ID = 8856 PLEASE NOTE - This product originates in Taiwan. If in stock in Taiwan, delivery is 10-14 days. If not in stock, lead times can be extended. We will inform you of any extended delays within 48 hours.
Alternate Names:anti-BXR antibody, anti-ONR1 antibody, anti-PAR antibody, anti-PAR1 antibody, anti-PAR2 antibody, anti-PARq antibody, anti-PRR antibody, anti-PXR antibody, anti-SAR antibody, anti-SXR antibody
Immunogen:NR1I2 (AAH17304, 279 a.a. ~ 379 a.a) partial recombinant protein with GST tag.
Epitope:LHEEEYVLMQAISLFSPDRPGVLQHRVVDQLQEQFAITLKSYIECNRPQPAHRFLFLKIMAMLTELRSINAQHTQRLLRIQDIHPFATPLMQELFGITGS* ...
Specificity:NR1I2 - nuclear receptor subfamily 1, group I, member 2
Purity:Whole antisera
Packaging:50 ul of mouse antisera with 50% glycerol. No preservative.
Package Size:50 ul
Uses:The quality control of this antibody is limited to Western blot on the immunizing protein. <br>Abnova's recommended working dilutions for western analysis are as follows:<br>1:500 dilution for ascites<br>1:1000 for purified Ig<b
Application Summary:ELISA, WB
Storage:Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Notes Main:This antibody is available only in North America and is supplied by Abnova The immunizing protein is also available for this product. Unit cost for the protein is $ 235 (2 ug), $ 285 (10 ug), and $ 425 (25 ug).
Gene Symbol:NR1I2
Omim ID:603065
see all human NR1I2 antibodies
see anti mouse secondary antibodies


2008©ExactAntigen home | browse | about