| request information: |
|
| Catalog Code: | H00008851-M01 |
| Product Name: | CDK5R1 Antibody |
| Product Description: | Mouse Monoclonal anti-CDK5R1 (4G11) |
| Clone: | 4G11 |
| Clonality: | Monoclonal |
| ListPrice: | 295 |
| Gene ID: | 8851 |
| Gene Symbol: | CDK5R1 |
| Omim ID: | 603460 |
| Immunogen: | CDK5R1 (AAH20580, 208 a.a. ~ 308 a.a) partial recombinant protein with GST tag. |
| Epitope: | CRDVISSEVGSDHELQAVLLTCLYLSYSYMGNEISYPLKPFLVESCKEAFWDRCLSVINLMSSKMLQINADPHYFTQVF
SDLKNESGQEDKKRLLLGLDR* |
| Specificity: | CDK5R1 - cyclin-dependent kinase 5, regulatory subunit 1 (p35) |
| Cross Reactivity: | Human. Other species not tested. |
| Packaging: | 0.1 mg IgG purified Mouse ascites. |
| Uses: | Antibody reactive against transfected lysate and recombinant protein for western blot. It has also been used for ELISA. |
| Background: | The protein encoded by this gene (p35) is a neuron-specific activator of cyclin-dependent kinase 5 (CDK5); the activation of CDK5 is required for proper development of the central nervous system. The p35 form of this protein is proteolytically cleaved by calpain, generating a p25 form. The cleavage of p35 into p25 results in relocalization of the protein from the cell periphery to nuclear and perinuclear regions. P25 deregulates CDK5 activity by prolonging its activation and changing its cellular location. The p25 form accumulates in the brain neurons of patients with Alzheimer's disease. This accumulation correlates with an increase in CDK5 kinase activity, and may lead to aberrantly phosphorylated forms of the microtubule-associated protein tau, which contributes to Alzheimer's disease. |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | IgG purified |
| Isotype: | IgG2a Kappa |
| Host Name: | Mouse |
| Application Summary: | ELISA, Western Blot |
| Species Summary: | Hu |
| Alternate Names: | anti-CDK5P35 antibody, anti-CDK5R antibody, anti-MGC33831 antibody, anti-NCK5A antibody, anti-p23 antibody, anti-p25 antibody, anti-p35 antibody, anti-p35nck5a antibody |
| Package Size: | 0.1 mg |
| Preservative: | No preservative |
order or
more information: | company product webpage |