ExactAntigen

PCAF Antibody | Novus Biologicals antibody product information
request information:
Catalog Code:H00008850-M06
Product Name:PCAF Antibody
Product Description:Mouse Monoclonal anti-PCAF (5E5)
Clone:5E5
Clonality:Monoclonal
ListPrice:295
Gene ID:8850
Gene Symbol:PCAF
Omim ID:602303,
Immunogen:PCAF (AAH60823, 353 a.a. ~ 452 a.a) partial recombinant protein with GST tag.
Epitope:LEEEVYSQNSPIWDQDFLSASSRTSQLGIQTVINPPPVAGTISYNSTSSSLEQPNAGSSSPACKASSGLEANPGEKRKM
TDSHVLEEAKKPRVMGDIPME
Cross Reactivity:Human. Other species not tested.
Packaging:0.1 mg IgG purified Mouse ascites.
Uses:Antibody reactive against cell lysate, tissue lysate and recombinant protein for western blot. It has also been used for ELISA.
Background:CBP and p300 are large nuclear proteins that bind to many sequence-specific factors involved in cell growth and/or differentiation, including c-jun and the adenoviral oncoprotein E1A. The protein encoded by this gene associates with p300/CBP. It has in vitro and in vivo binding activity with CBP and p300, and competes with E1A for binding sites in p300/CBP. It has histone acetyl transferase activity with core histones and nucleosome core particles, indicating that this protein plays a direct role in transcriptional regulation.
Storage:Aliquot and store at -20C or -80C.  Avoid freeze-thaw cycles.
Purity:IgG purified
Isotype:IgG2a Kappa
Host Name:Mouse
Buffer:In 1x PBS, pH 7.2
Application Summary:ELISA, Western Blot
Species Summary:Hu
Alternate Names:anti-CAF antibody, anti-GCN5 antibody, anti-GCN5L antibody, anti-GCN5L1 antibody, anti-P/CAF antibody
Package Size:0.1 mg
Preservative:No preservative
order or
more information
:
company product webpage
Also see:
all human KAT2B antibodies


2008©ExactAntigen home | browse | about