| request information: | |
| Catalog Code: | H00008850-M02 |
| Product Name: | PCAF Antibody |
| Product Description: | Mouse Monoclonal anti-PCAF (1H2) |
| Clone: | 1H2 |
| Clonality: | Monoclonal |
| ListPrice: | 295 |
| Gene ID: | 8850 |
| Gene Symbol: | PCAF |
| Omim ID: | 602303, |
| Immunogen: | PCAF (AAH60823, 353 a.a. ~ 452 a.a) partial recombinant protein with GST tag. |
| Epitope: | LEEEVYSQNSPIWDQDFLSASSRTSQLGIQTVINPPPVAGTISYNSTSSSLEQPNAGSSSPACKASSGLEANPGEKRKM TDSHVLEEAKKPRVMGDIPME |
| Cross Reactivity: | Human. Other species not tested. |
| Packaging: | 0.1 mg IgG purified Mouse ascites. |
| Uses: | Antibody reactive against cell lysate, tissue lysate and recombinant protein for western blot. It has also been used for RNAi validation and ELISA. |
| Background: | CBP and p300 are large nuclear proteins that bind to many sequence-specific factors involved in cell growth and/or differentiation, including c-jun and the adenoviral oncoprotein E1A. The protein encoded by this gene associates with p300/CBP. It has in vitro and in vivo binding activity with CBP and p300, and competes with E1A for binding sites in p300/CBP. It has histone acetyl transferase activity with core histones and nucleosome core particles, indicating that this protein plays a direct role in transcriptional regulation. |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | IgG purified |
| Isotype: | IgG2a Kappa |
| Host Name: | Mouse |
| Buffer: | In 1x PBS, pH 7.2 |
| Application Summary: | ELISA, Western Blot, RNAi Validation |
| Species Summary: | Hu |
| Alternate Names: | anti-CAF antibody, anti-GCN5 antibody, anti-GCN5L antibody, anti-P/CAF antibody |
| Package Size: | 0.1 mg |
| Preservative: | No preservative |
order or more information: | company product webpage |