ExactAntigen

Mouse Monoclonal anti-PCAF (2B4)
For more information about this product,
enter your email address here
or visit directly company product webpage
.
CatalogCode:H00008850-M01
ProductName:PCAF Antibody
Product Description:Mouse Monoclonal anti-PCAF (2B4)
Clone:2B4
Clonality:Monoclonal
Immunogen:PCAF (AAH60823, 353 a.a. ~ 452 a.a) partial recombinant protein with GST tag.
Epitope:LEEEVYSQNSPIWDQDFLSASSRTSQLGIQTVINPPPVAGTISYNSTSSSLEQPNAGSSSPACKASSGLEANPGEKRKMTDSHVLEEAKKPRVMGDIPME ...
Specificity:PCAF - p300/CBP-associated factor
CrossReactivity:Human. Other species not tested.
Packaging:0.1 mg IgG purified Mouse ascites.
Uses:Antibody Reactive against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control.
Background:CBP and p300 are large nuclear proteins that bind to many sequence-specific factors involved in cell growth and/or differentiation, including c-jun and the adenoviral oncoprotein E1A. The protein encoded by this gene associates with p300/CBP. It has in vitro and in vivo binding activity with CBP and p300, and competes with E1A for binding sites in p300/CBP. It has histone acetyl transferase activity with core histones and nucleosome core particles, indicating that this protein plays a direct role in transcriptional regulation.
Storage:Aliquot and store at -20C or -80C.  Avoid freeze-thaw cycles.
Purity:IgG purified
Isotype:IgG2b Kappa
Host_Name:Mouse
ListPrice:295
AppSummary:ELISA, WB
SpeciesSummary:Hu
ALTnames:anti-CAF antibody, anti-GCN5 antibody, anti-GCN5L antibody, anti-P/CAF antibody
ProteinTarget:PCAF - p300/CBP-associated factor
PackageSize:0.1 mg
NotesMain:This antibody is available only in North America and is supplied by Abnova If in stock in Taiwan. delivery is 10-14 days. If not in stock. lead times can be extended. We will inform you of any extended delays within 48 hours. The immunizing protein is also available for this product. Unit cost for the protein is $ 250 (2 ug). $ 305 (10 ug). and $ 445 (25 ug).
Gene_Id:8850
Gene_Symbol:PCAF
Omim_ID:602303 H00005092-A01
see all human PCAF antibodies
see anti mouse secondary antibodies


2008©ExactAntigen home | browse | about