| request information: |
|
| Catalog Code: | H00008848-M01 |
| Product Name: | TSC22D1 Antibody |
| Product Description: | Mouse Monoclonal anti-TSC22D1 (1G7) |
| Clone: | 1G7 |
| Clonality: | Monoclonal |
| ListPrice: | 295 |
| Gene ID: | 8848 |
| Gene Symbol: | TSC22D1 |
| Omim ID: | 607715 |
| Immunogen: | TSC22D1 (AAH00456, 1 a.a. ~ 145 a.a) full length recombinant protein with GST tag. |
| Epitope: | MKSQWCRPVAMDLGVYQLRHFSISFLSSLLGTENASVRLDNSSSGASVVAIDNKIEQAMDLVKSHLMYAVREEVEVLKE
QIKELIEKNSQLEQENNLLKTLASPEQLAQFQAQLQTGSPPATTQPQGTTQPPAQPASQGSGPTA* |
| Specificity: | TSC22D1 - TSC22 domain family 1 |
| Cross Reactivity: | Human. Other species not tested. |
| Packaging: | 0.1 mg IgG purified Mouse ascites. |
| Uses: | Antibody reactive against recombinant protein for Western Blot. Has also been used for immunofluoresence and ELISA. |
| Background: | TSC22D1 encodes a transcription factor and belongs to the large family of early response genes.[supplied by OMIM] |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | IgG purified |
| Isotype: | IgG1 kappa |
| Host Name: | Mouse |
| Application Summary: | ELISA, immunofluorescence, Western Blot |
| Species Summary: | Hu |
| Alternate Names: | anti-DKFZp686O19206 antibody, anti-MGC17597 antibody, anti-TGFB1I4 antibody, anti-TSC22 antibody |
| Package Size: | 0.1 mg |
| Preservative: | No preservative |
order or
more information: | company product webpage |