| request information: |
|
| Catalog Code: | H00008841-M01 |
| Product Name: | HDAC3 Antibody |
| Product Description: | Mouse Monoclonal anti-HDAC3 (2F9-4B7) |
| Clone: | 2F9-4B7 |
| Clonality: | Monoclonal |
| ListPrice: | 295 |
| Gene ID: | 8841 |
| Gene Symbol: | HDAC3 |
| Omim ID: | 605166, |
| Immunogen: | HDAC3 (AAH00614, 1 a.a. ~ 429 a.a) full length recombinant protein with GST tag. |
| Epitope: | MAKTVAYFYDPDVGNFHYGAGHPMKPHRLALTHSLVLHYGLYKKMIVFKPYQASQHDMCRFHSEDYIDFLQRVSPTNMQ
GFTKSLNAFNVGDDCPVFPGLFEFCSRYTGASLQGATQLNNKICDIAINWAGGLHHAKKFEASGFCYVNDIVIGILELL
KYHPRVLYIDIDIHHGDGVQEAFYLTDRVMTVSFHKYGNYFFPGTGDMYEVGAESGRYYCLNVPLRDGIDDQSYKHLFQ
PVINQVVDFYQPTCIVLQ |
| Specificity: | HDAC3 - histone deacetylase 3 |
| Cross Reactivity: | Human. Other species not tested. |
| Packaging: | 0.1 mg IgG purified Mouse ascites. |
| Uses: | Antibody reactive against recombinant protein on ELISA. |
| Background: | Histones play a critical role in transcriptional regulation, cell cycle progression, and developmental events. Histone acetylation/deacetylation alters chromosome structure and affects transcription factor access to DNA. The protein encoded by this gene belongs to the histone deacetylase/acuc/apha family. It has histone deacetylase activity and represses transcription when tethered to a promoter. It may participate in the regulation of transcription through its binding with the zinc-finger transcription factor YY1. This protein can also down-regulate p53 function and thus modulate cell growth and apoptosis. This gene is regarded as a potential tumor suppressor gene. |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | IgG purified |
| Isotype: | IgG1 Kappa |
| Host Name: | Mouse |
| Application Summary: | ELISA |
| Species Summary: | Hu |
| Alternate Names: | anti-HD3 antibody, anti-RPD3 antibody, anti-RPD3-2 antibody |
| Package Size: | 0.1 mg |
| Preservative: | No preservative |
order or
more information: | company product webpage |