| request information: |
|
| Catalog Code: | H00008835-A01 |
| Product Name: | SOCS2 Antibody |
| Product Description: | Mouse Polyclonal anti-SOCS2 |
| Clonality: | Polyclonal |
| ListPrice: | 225 |
| Gene ID: | 8835 |
| Gene Symbol: | SOCS2 |
| Omim ID: | 605117 |
| Immunogen: | SOCS2 (AAH10399, 99 a.a. ~ 198 a.a) partial recombinant protein with GST tag. |
| Epitope: | YQDGKFRLDSIICVKSKLKQFDSVVHLIDYYVQMCKDKRTGPEAPRNGTVHLYLTKPLYTSAPSLQHLCRLTINKCTGA
IWGLPLPTRLKDYLEEYKFQV |
| Specificity: | SOCS2 - suppressor of cytokine signaling 2 |
| Cross Reactivity: | Human. Other species not tested. |
| Packaging: | 0.05 ml of mouse antisera with 50% glycerol. No preservative. |
| Uses: | The quality control of this antibody is limited to Western blot on the immunizing protein. Abnovas recommended working dilutions for western analysis are as follows:1:500 dilution for ascites1:1000 for purified Ig1:500-1:1000 for polysera |
| Background: | This gene encodes a member of the STAT-induced STAT inhibitor (SSI), also known as suppressor of cytokine signaling (SOCS), family. SSI family members are cytokine-inducible negative regulators of cytokine signaling. The expression of this gene can be induced by a subset of cytokines, including erythropoietin, GM-CSF, IL10 and interferon (IFN)-gamma. The protein encoded by this gene is found to interact with the cytoplasmic domain of insulin-like growth factor-1 receptor (IGF1R), and thus is thought to be involved in the regulation of IGF1R mediated cell signaling. Knockout studies in mice also suggested a regulatory role of this gene in IGF-1 related growth control. |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | Whole antisera |
| Host Name: | Mouse |
| Application Summary: | ELISA, Western Blot |
| Species Summary: | Hu |
| Alternate Names: | anti-CIS2 antibody, anti-Cish2 antibody, anti-SOCS-2 antibody, anti-SSI-2 antibody, anti-SSI2 antibody, anti-STATI2 antibody |
| Package Size: | 0.05 ml |
| Preservative: | No preservative |
order or
more information: | company product webpage |