ExactAntigen

Mouse Monoclonal anti-NRP2 (3B8) | Novus Biologicals antibody product information
To request information:
enter your email address here
CatalogCode: H00008828-M01
ProductName: NRP2 Antibody
Product Description: Mouse Monoclonal anti-NRP2 (3B8)
Clone: 3B8
Clonality: Monoclonal
Immunogen: NRP2 (NP_958436, 621 a.a. ~ 716 a.a) partial recombinant protein with GST tag.
Epitope: EEATECGENCSFEDDKDLQLPSGFNCNFDFLEEPCGWMYDHAKWLRTTWASSSSPNDRTFPDDRNFLRLQSDSQREGQYARLISPPVHLPRSPVC* ...
Specificity: NRP2 - neuropilin 2
CrossReactivity: Human. Other species not tested.
Packaging: 0.1 mg IgG purified Mouse ascites.
Uses: Antibody Reactive against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control.
Background: This gene encodes a member of the neuropilin family of receptor proteins. The encoded transmembrane protein binds to SEMA3C protein {sema domain, immunoglobulin domain (Ig), short basic domain, secreted, (semaphorin) 3C} and SEMA3F protein {sema domain, immunoglobulin domain (Ig), short basic domain, secreted, (semaphorin) 3F}, and interacts with vascular endothelial growth factor (VEGF). This protein may play a role in cardiovascular development, axon guidance, and tumorigenesis. Multiple transcript variants encoding distinct isoforms have been identified for this gene.
Storage: Aliquot and store at -20C or -80C.  Avoid freeze-thaw cycles.
Purity: IgG purified
Isotype: IgG1 Kappa
Host_Name: Mouse
ListPrice: 295
AppSummary: ELISA, WB
SpeciesSummary: Hu
ALTnames: anti-MGC126574 antibody, anti-NP2 antibody, anti-NPN2 antibody, anti-PRO2714 antibody, anti-VEGF165R2 antibody
ProteinTarget: NRP2 - neuropilin 2
PackageSize: 0.1 mg
NotesMain: This antibody is available only in North America and is supplied by Abnova If in stock in Taiwan. delivery is 10-14 days. If not in stock. lead times can be extended. We will inform you of any extended delays within 48 hours. The immunizing protein is also available for this product. Unit cost for the protein is $ 250 (2 ug). $ 305 (10 ug). and $ 445 (25 ug).
Gene_Id: 8828
Gene_Symbol: NRP2
Omim_ID: 602070,
more information: company product webpage
Also see:
see all human NRP2 antibodies
see anti mouse secondary antibodies


2008©ExactAntigen home | browse | about