| Catalog Code: | H00008828-A01 |
| Product Type: | Primary Antibody |
| Product Name: | NRP2 Antibody |
| List Price: | 205 |
| Clonality: | Polyclonal |
| Gene ID: | 8828 |
| Host: | Mouse |
| Product Description: | Mouse Polyclonal anti-NRP2 |
| Cross Reactivity: | Human. Other species not tested. |
| Species Summary: | Hu |
| Background: | This gene encodes a member of the neuropilin family of receptor proteins. The encoded transmembrane protein binds to SEMA3C protein {sema domain, immunoglobulin domain (Ig), short basic domain, secreted, (semaphorin) 3C} and SEMA3F protein {sema domain, i |
| Alternate Names: | anti-MGC126574 antibody, anti-NP2 antibody, anti-NPN2 antibody, anti-PRO2714 antibody, anti-VEGF165R2 antibody |
| Immunogen: | NRP2 (NP_958436, 621 a.a. ~ 716 a.a) partial recombinant protein with GST tag. |
| Epitope: | EEATECGENCSFEDDKDLQLPSGFNCNFDFLEEPCGWMYDHAKWLRTTWASSSSPNDRTFPDDRNFLRLQSDSQREGQYARLISPPVHLPRSPVC* ... |
| Specificity: | Mouse polyclonal antibody raised against a partial recombinant NRP2. |
| Purity: | Whole antisera |
| Packaging: | 50 ul of mouse antisera with 50% glycerol. |
| Package Size: | 0.05 ml |
| Uses: | The quality control of this antibody is limited to ELISA and Western blot on the immunizing protein. Abnova's recommended working dilutions for western analysis are as follows: 1:500 dilution for ascites 1:1000 for purified Ig1:500-1:1000 for polysera |
| Application Summary: | ELISA, WB |
| Notes Main: | This antibody is available only in North America and is supplied by Abnova The immunizing protein is also available for this product. Unit cost for the protein is $ 235 (2 ug), $ 285 (10 ug), and $ 425 (25 ug). |
| Gene Symbol: | NRP2 |
| Omim ID: | 602070, |