ExactAntigen

NRP2 Antibody
For more information about this product,
enter your email address here
or visit directly company product webpage
.
Catalog Code:H00008828-A01
Product Type:Primary Antibody
Product Name:NRP2 Antibody
List Price:205
Clonality:Polyclonal
Gene ID:8828
Host:Mouse
Product Description:Mouse Polyclonal anti-NRP2
Cross Reactivity:Human. Other species not tested.
Species Summary:Hu
Background:This gene encodes a member of the neuropilin family of receptor proteins. The encoded transmembrane protein binds to SEMA3C protein {sema domain, immunoglobulin domain (Ig), short basic domain, secreted, (semaphorin) 3C} and SEMA3F protein {sema domain, i
Alternate Names:anti-MGC126574 antibody, anti-NP2 antibody, anti-NPN2 antibody, anti-PRO2714 antibody, anti-VEGF165R2 antibody
Immunogen:NRP2 (NP_958436, 621 a.a. ~ 716 a.a) partial recombinant protein with GST tag.
Epitope:EEATECGENCSFEDDKDLQLPSGFNCNFDFLEEPCGWMYDHAKWLRTTWASSSSPNDRTFPDDRNFLRLQSDSQREGQYARLISPPVHLPRSPVC* ...
Specificity:Mouse polyclonal antibody raised against a partial recombinant NRP2.
Purity:Whole antisera
Packaging:50 ul of mouse antisera with 50% glycerol.
Package Size:0.05 ml
Uses:The quality control of this antibody is limited to ELISA and Western blot on the immunizing protein. Abnova's recommended working dilutions for western analysis are as follows: 1:500 dilution for ascites 1:1000 for purified Ig1:500-1:1000 for polysera
Application Summary:ELISA, WB
Notes Main:This antibody is available only in North America and is supplied by Abnova The immunizing protein is also available for this product. Unit cost for the protein is $ 235 (2 ug), $ 285 (10 ug), and $ 425 (25 ug).
Gene Symbol:NRP2
Omim ID:602070,
see all human NRP2 antibodies
see anti mouse secondary antibodies


2008©ExactAntigen home | browse | about