| request information: |
|
| Catalog Code: | H00008824-M02 |
| Product Name: | CES2 Antibody |
| Product Description: | Mouse Monoclonal anti-CES2 (4F12) |
| Clone: | 4F12 |
| Clonality: | Monoclonal |
| ListPrice: | 295 |
| Gene ID: | 8824 |
| Gene Symbol: | CES2 |
| Omim ID: | 605278, |
| Immunogen: | CES2 (NP_003860, 514 a.a. ~ 622 a.a) partial recombinant protein with GST tag. |
| Epitope: | PPHMKADHGDELPFVFRSFFGGNYIKFTEEEEQLSRKMMKYWANFARNGNPNGEGLPHWPLFDQEEQYLQLNLQPAVGR
ALKAHRLQFWKKALPQKIQELEEPEERHT* |
| Cross Reactivity: | Human. Other species not tested. |
| Packaging: | 0.1 mg IgG purified Mouse ascites. |
| Uses: | Antibody reactive against cell lysate and recombinant protein for Western Blot. Has also been used for immunohistochemistry (paraffin) and ELISA. |
| Background: | Carboxylesterase 2 is a member of a large multigene family. The enzymes encoded by these genes are responsible for the hydrolysis of ester- and amide-bond-containing drugs such as cocaine and heroin. They also hydrolize long-chain fatty acid esters and thioesters. The specific function of this enzyme has not yet been determined; however, it is speculated that carboxylesterases may play a role in lipid metabolism and/or the blood-brain barrier system. Two alternatively spliced transcript variants encoding distinct isoforms have been found for this gene. |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | IgG purified |
| Isotype: | IgG2b Kappa |
| Host Name: | Mouse |
| Buffer: | In 1x PBS, pH 7.2 |
| Application Summary: | ELISA, Immunohistochemistry-Paraffin, Western Blot |
| Species Summary: | Hu |
| Alternate Names: | anti-CE-2 antibody, anti-iCE antibody |
| Package Size: | 0.1 mg |
| Preservative: | No preservative |
order or
more information: | company product webpage |