| Catalog Code: | H00008819-A01 |
| Product Type: | Primary Antibody |
| Product Name: | SAP30 Antibody |
| List Price: | 205 |
| Clonality: | Polyclonal |
| Gene ID: | 8819 |
| Host: | Mouse |
| Product Description: | Mouse Polyclonal anti-SAP30 |
| Cross Reactivity: | Human. Other species not tested. |
| Species Summary: | Hu |
| Background: | Histone acetylation plays a key role in the regulation of eukaryotic gene expression. Histone acetylation and deacetylation are catalyzed by multisubunit complexes. The protein encoded by this gene is a component of the histone deacetylase complex, which |
| Immunogen: | SAP30 (NP_003855, 131 a.a. ~ 220 a.a) partial recombinant protein with GST tag. |
| Epitope: | SDDDGGDSPVQDIDTPEVDLYQLQVNTLRRYKRHFKLPTRPGLNKAQLVEIVGCHFRSIPVNEKDTLTYFIYSVKNDKNKSDLKVDSGV* ... |
| Specificity: | SAP30 - sin3-associated polypeptide, 30kDa |
| Purity: | Whole antisera |
| Packaging: | 50 ul of mouse antisera with 50% glycerol. No preservative. |
| Package Size: | 50 ul |
| Uses: | The quality control of this antibody is limited to Western blot on the immunizing protein and cell lysates. Abnova's recommended working dilutions for western analysis are as follows:1:500-1:1000 for polysera |
| Application Summary: | ELISA, WB |
| Notes Main: | This antibody is available only in North America and is supplied by Abnova The immunizing protein is also available for this product. Unit cost for the protein is $ 235 (2 ug), $ 285 (10 ug), and $ 425 (25 ug). |
| Gene Symbol: | SAP30 |
| Omim ID: | 603378 |