ExactAntigen

CDKL1 Antibody | Novus Biologicals antibody product information
request information:
Catalog Code:H00008814-M03
Product Name:CDKL1 Antibody
Product Description:Mouse Monoclonal anti-CDKL1 (1F12)
Clone:1F12
Clonality:Monoclonal
ListPrice:295
Gene ID:8814
Gene Symbol:CDKL1
Omim ID:603441,
Immunogen:CDKL1 (NP_004187, 259 a.a. ~ 358 a.a) partial recombinant protein with GST tag.
Epitope:YPALGLLKGCLHMDPTQRLTCEQLLHHPYFENIREIEDLAKE HNKPTRKTLRKSRKHHCFTETSKLQYLPQLTGSSILPALDNK KYYCDTKKLNYRFPNI
Specificity:CDKL1 - cyclin-dependent kinase-like 1 (CDC2-related kinase)
Cross Reactivity:Human. Other species not tested.
Packaging:0.1 mg IgG purified Mouse ascites.
Uses:Antibody reactive against recombinant protein for Western Blot. Has also been used for immunohistochemistry (paraffin) and ELISA.
Background:This gene product is a member of a large family of CDC2-related serine/threonine protein kinases. It accumulates primarily in the nucleus. Alternative splice variants encoding different protein isoforms have been described, but their full-length nature has not been determined.
Storage:Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Purity:IgG purified
Isotype:IgG2a Kappa
Host Name:Mouse
Buffer:Phosphate buffered saline, pH 7.2
Application Summary:ELISA, Immunohistochemistry-Paraffin, Western Blot
Species Summary:Hu ,
Alternate Names:anti-CDC 2 related kinase 1 antibody, anti-CDC 2 related kinase antibody, anti-CDC2 related kinase 1 antibody, anti-CDC2 related kinase antibody, anti-CDK L1 antibody, anti-CDKL 1 antibody, anti-Cyclin dependent kinase like 1 antibody, anti-EC 2.7.11.22 antibody, anti-KKIALRE antibody, anti-p42 antibody, anti-Protein kinase p42 KKIALRE antibody, anti-Serine/threonine protein kinase KKIALRE antibody
Package Size:0.1 mg
Preservative:No preservative
order or
more information
:
company product webpage
Also see:
all human CDKL1 antibodies


2008©ExactAntigen home | browse | about