| request information: | |
| Catalog Code: | H00008814-M02 |
| Product Name: | CDKL1 Antibody |
| Product Description: | Mouse Monoclonal anti-CDKL1 (8B2) |
| Clone: | 8B2 |
| Clonality: | Monoclonal |
| ListPrice: | 295 |
| Gene ID: | 8814 |
| Gene Symbol: | CDKL1 |
| Omim ID: | 603441, |
| Immunogen: | CDKL1 (NP_004187, 259 a.a. ~ 358 a.a) partial recombinant protein with GST tag. |
| Epitope: | YPALGLLKGCLHMDPTQRLTCEQLLHHPYFENIREIEDLAKE HNKPTRKTLRKSRKHHCFTETSKLQYLPQLTGSSILPALDNK KYYCDTKKLNYRFPNI |
| Specificity: | CDKL1 - cyclin-dependent kinase-like 1 (CDC2-related kinase) |
| Cross Reactivity: | Human. Other species not tested. |
| Packaging: | 0.1 mg IgG purified Mouse ascites. |
| Uses: | Antibody reactive against recombinant protein on ELISA. |
| Background: | This gene product is a member of a large family of CDC2-related serine/threonine protein kinases. It accumulates primarily in the nucleus. Alternative splice variants encoding different protein isoforms have been described, but their full-length nature has not been determined. |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | IgG purified |
| Isotype: | IgG2b Kappa |
| Host Name: | Mouse |
| Buffer: | Phosphate buffered saline, pH 7.2 |
| Application Summary: | ELISA |
| Species Summary: | Hu |
| Alternate Names: | anti-CDC 2 related kinase 1 antibody, anti-CDC 2 related kinase antibody, anti-CDC2 related kinase 1 antibody, anti-CDC2 related kinase antibody, anti-CDK L1 antibody, anti-CDKL 1 antibody, anti-Cyclin dependent kinase like 1 antibody, anti-EC 2.7.11.22 antibody, anti-KKIALRE antibody, anti-p42 antibody, anti-Protein kinase p42 KKIALRE antibody, anti-Serine/threonine protein kinase KKIALRE antibody |
| Package Size: | 0.1 mg |
| Preservative: | No preservative |
order or more information: | company product webpage |