| request information: |
|
| Catalog Code: | H00008808-A01 |
| Product Name: | IL1RL2 Antibody |
| Product Description: | Mouse Polyclonal anti-IL1RL2 |
| Clonality: | Polyclonal |
| ListPrice: | 225 |
| Gene ID: | 8808 |
| Gene Symbol: | IL1RL2 |
| Omim ID: | 604512 |
| Immunogen: | IL1RL2 (NP_003845, 20 a.a. ~ 119 a.a) partial recombinant protein with GST tag. |
| Epitope: | DGCKDIFMKNEILSASQPFAFNCTFPPITSGEVSVTWYKNSSKIPVSKIIQSRIHQDETWILFLPMEWGDSGVYQCVIK
GRDSCHRIHVNLTVFEKHWC* |
| Specificity: | IL1RL2 - interleukin 1 receptor-like 2 |
| Cross Reactivity: | Human. Other species not tested. |
| Packaging: | 0.05 ml of mouse antisera with 50% glycerol. No preservative. |
| Uses: | The quality control of this antibody is limited to Western blot on the immunizing protein. Abnovas recommended working dilutions for western analysis are as follows:1:500 dilution for ascites1:1000 for purified Ig1:500-1:1000 for polysera |
| Background: | The protein encoded by this gene is a member of the interleukin 1 receptor family. An experiment with transient gene expression demonstrated that this receptor was incapable of binding to interleukin 1 alpha and interleukin 1 beta with high affinity. This gene and four other interleukin 1 receptor family genes, including interleukin 1 receptor, type I (IL1R1), interleukin 1 receptor, type II (IL1R2), interleukin 1 receptor-like 1 (IL1RL1), and interleukin 18 receptor 1 (IL18R1), form a cytokine receptor gene cluster in a region mapped to chromosome 2q12. |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | Whole antisera |
| Host Name: | Mouse |
| Application Summary: | ELISA, Western Blot |
| Species Summary: | Hu |
| Alternate Names: | anti-IL1R-rp2 antibody, anti-IL1RRP2 antibody |
| Package Size: | 0.05 ml |
| Preservative: | No preservative |
order or
more information: | company product webpage |