| request information: |
|
| Catalog Code: | H00008804-M01 |
| Product Name: | CREG1 Antibody |
| Product Description: | Mouse Monoclonal anti-CREG1 (1B7) |
| Clone: | 1B7 |
| Clonality: | Monoclonal |
| ListPrice: | 295 |
| Gene ID: | 8804 |
| Gene Symbol: | CREG1 |
| Immunogen: | CREG1 (NP_003842, 121 a.a. ~ 221 a.a) partial recombinant protein with GST tag. |
| Epitope: | PYATLTMTLAQTNFCKKHGFDPQSPLCVHIMLSGTVTKVNETEMDIAKHSLFIRHPEMKTWPSSHNWFFAKLNITNIWV
LDYFGGPKIVTPEEYYNVTVQ* |
| Specificity: | CREG1 - cellular repressor of E1A-stimulated genes 1 |
| Cross Reactivity: | Human. Other species not tested. |
| Packaging: | 0.1 mg IgG purified Mouse ascites. |
| Uses: | Antibody reactive against cell lysate and recombinant protein for Western Blot. Has also been used for immunohistochemistry (paraffin) and ELISA. |
| Background: | The adenovirus E1A protein both activates and represses gene expression to promote cellular proliferation and inhibit differentiation. The protein encoded by this gene antagonizes transcriptional activation and cellular transformation by E1A. This protein shares limited sequence similarity with E1A and binds both the general transcription factor TBP and the tumor suppressor pRb in vitro. This gene may contribute to the transcriptional control of cell growth and differentiation. |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | IgG purified |
| Isotype: | IgG1 Kappa |
| Host Name: | Mouse |
| Application Summary: | ELISA, Immunohistochemistry-Paraffin, Western Blot |
| Species Summary: | Hu |
| Alternate Names: | anti-CREG antibody |
| Package Size: | 0.1 mg |
| Preservative: | No preservative |
order or
more information: | company product webpage |