| request information: |
|
| Catalog Code: | H00008804-A01 |
| Product Name: | CREG1 Antibody |
| Product Description: | Mouse Polyclonal anti-CREG1 |
| Clonality: | Polyclonal |
| ListPrice: | 225 |
| Gene ID: | 8804 |
| Gene Symbol: | CREG1 |
| Immunogen: | CREG1 (NP_003842, 121 a.a. ~ 221 a.a) partial recombinant protein with GST tag. |
| Epitope: | PYATLTMTLAQTNFCKKHGFDPQSPLCVHIMLSGTVTKVNETEMDIAKHSLFIRHPEMKTWPSSHNWFFAKLNITNIWV
LDYFGGPKIVTPEEYYNVTVQ* |
| Specificity: | CREG1 - cellular repressor of E1A-stimulated genes 1 |
| Cross Reactivity: | Human. Other species not tested. |
| Packaging: | 0.05 ml of mouse antisera with 50% glycerol. No preservative. |
| Uses: | The quality control of this antibody is limited to Western blot on the immunizing protein. Abnovas recommended working dilutions for western analysis are as follows:1:500 dilution for ascites1:1000 for purified Ig1:500-1:1000 for polysera |
| Background: | The adenovirus E1A protein both activates and represses gene expression to promote cellular proliferation and inhibit differentiation. The protein encoded by this gene antagonizes transcriptional activation and cellular transformation by E1A. This protein shares limited sequence similarity with E1A and binds both the general transcription factor TBP and the tumor suppressor pRb in vitro. This gene may contribute to the transcriptional control of cell growth and differentiation. |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | Whole antisera |
| Host Name: | Mouse |
| Application Summary: | ELISA, Western Blot |
| Species Summary: | Hu |
| Alternate Names: | anti-CREG antibody |
| Package Size: | 0.05 ml |
| Preservative: | No preservative |
order or
more information: | company product webpage |