| request information: |
|
| Catalog Code: | H00008772-A01 |
| Product Name: | FADD Antibody |
| Product Description: | Mouse Polyclonal anti-FADD |
| Clonality: | Polyclonal |
| ListPrice: | 225 |
| Gene ID: | 8772 |
| Gene Symbol: | FADD |
| Omim ID: | 602457 |
| Immunogen: | FADD (AAH00334, 109 a.a. ~ 208 a.a) partial recombinant protein with GST tag. |
| Epitope: | GKDWRRLARQLKVSDTKIDSIEDRYPRNLTERVRESLRIWKNTEKENATVAHLVGALRSCQMNLVADLVQEVQQARDLQ
NRSGAMSPMSWNSDASTSEAS |
| Specificity: | FADD - Fas (TNFRSF6)-associated via death domain |
| Cross Reactivity: | Human. Other species not tested. |
| Packaging: | 0.05 ml of mouse antisera with 50% glycerol. No preservative. |
| Uses: | The quality control of this antibody is limited to Western blot on the immunizing protein. Abnovas recommended working dilutions for western analysis are as follows:1:500 dilution for ascites1:1000 for purified Ig1:500-1:1000 for polysera |
| Background: | The protein encoded by this gene is an adaptor molecule that interacts with various cell surface receptors and mediates cell apoptotic signals. Through its C-terminal death domain, this protein can be recruited by TNFRSF6/Fas-receptor, tumor necrosis factor receptor, TNFRSF25, and TNFSF10/TRAIL-receptor, and thus it participates in the death signaling initiated by these receptors. Interaction of this protein with the receptors unmasks the N-terminal effector domain of this protein, which allows it to recruit caspase-8, and thereby activate the cysteine protease cascade. Knockout studies in mice also suggest the importance of this protein in early T cell development. |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | Whole antisera |
| Host Name: | Mouse |
| Application Summary: | ELISA, Western Blot |
| Species Summary: | Hu |
| Alternate Names: | anti-GIG3 antibody, anti-MGC8528 antibody, anti-MORT1 antibody |
| Package Size: | 0.05 ml |
| Preservative: | No preservative |
order or
more information: | company product webpage |