| request information: |
|
| Catalog Code: | H00008742-M01 |
| Product Name: | TNFSF12 Antibody |
| Product Description: | Mouse Monoclonal anti-TNFSF12 (4H3) |
| Clone: | 4H3 |
| Clonality: | Monoclonal |
| ListPrice: | 295 |
| Gene ID: | 8742 |
| Gene Symbol: | TNFSF12 |
| Omim ID: | 602695 |
| Immunogen: | TNFSF12 (AAH19047, 49 a.a. ~ 135 a.a) partial recombinant protein with GST tag. |
| Epitope: | SLSAQEPAQEELVAEEDQDPSELNPQTEESQDPAPFLNRLVRPRRSAPKGRKTRARRAIAAHYEVHPRPGQDGAQADGG
YTTCLRP* |
| Specificity: | TNFSF12 - tumor necrosis factor (ligand) superfamily, member 12 |
| Cross Reactivity: | Human. Other species not tested. |
| Packaging: | 0.1 mg IgG purified Mouse ascites. |
| Uses: | Antibody Reactive against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control. |
| Background: | The protein encoded by this gene is a cytokine that belongs to the tumor necrosis factor (TNF) ligand family. This protein is a ligand for the FN14/TWEAKR receptor. This cytokine has overlapping signaling functions with TNF, but displays a much wider tissue distribution. This cytokine can induce apoptosis via multiple pathways of cell death in a cell type-specific manner. This cytokine is also found to promote proliferation and migration of endothelial cells, and thus acts as a regulator of angiogenesis. |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | IgG purified |
| Isotype: | IgG2a Kappa |
| Host Name: | Mouse |
| Application Summary: | ELISA, Western Blot |
| Species Summary: | Hu |
| Alternate Names: | anti-APO3L antibody, anti-DR3LG antibody, anti-MGC20669 antibody, anti-TWEAK antibody |
| Package Size: | 0.1 mg |
| Preservative: | No preservative |
order or
more information: | company product webpage |