| request information: |
|
| Catalog Code: | H00008725-A01 |
| Product Name: | C19orf2 Antibody |
| Product Description: | Mouse Polyclonal anti-C19orf2 |
| Clonality: | Polyclonal |
| ListPrice: | 225 |
| Gene ID: | 8725 |
| Gene Symbol: | C19orf2 |
| Omim ID: | 603494 |
| Immunogen: | C19orf2 (NP_003787, 371 a.a. ~ 476 a.a) partial recombinant protein with GST tag. |
| Epitope: | NSTGSGHSAQELPTIRTPADIYRAFVDVVNGEYVPRKSILKSRSRENSVCSDTSESSAAEFDDRRGVLRSISCEEATCS
DTSESILEEEPQENQKKLLPLSVTPE* |
| Specificity: | C19orf2 - chromosome 19 open reading frame 2 |
| Cross Reactivity: | Human. Other species not tested. |
| Packaging: | 0.05 ml of mouse antisera with 50% glycerol. No preservative. |
| Uses: | The quality control of this antibody is limited to Western blot on the immunizing protein. Abnovas recommended working dilutions for western analysis are as follows:1:500 dilution for ascites1:1000 for purified Ig1:500-1:1000 for polysera |
| Background: | The protein encoded by this gene binds to RNA polymerase II subunit 5 (RPB5) and negatively modulates transcription through its binding to RPB5. The encoded protein seems to have inhibitory effects on various types of activated transcription, but it requires the RPB5-binding region. This protein acts as a corepressor. It is suggested that it may require signaling processes for its function or that it negatively modulates genes in the chromatin structure. Two alternatively spliced transcript variants encoding different isoforms have been described for this gene. |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | Whole antisera |
| Host Name: | Mouse |
| Application Summary: | ELISA, Western Blot |
| Species Summary: | Hu |
| Alternate Names: | anti-FLJ10575 antibody, anti-NNX3 antibody, anti-RMP antibody, anti-URI antibody |
| Package Size: | 0.05 ml |
| Preservative: | No preservative |
order or
more information: | company product webpage |